Property Summary

NCBI Gene PubMed Count 43
Grant Count 13
R01 Count 8
Funding $1,344,664.57
PubMed Score 28.40
PubTator Score 38.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.500 0.042
group 3 medulloblastoma 1.200 0.001

Gene RIF (30)

PMID Text
26734725 The interaction of MDC1 with RNF8, but not with ATM requires WRAP53beta, suggesting that WRAP53beta facilitates the former interaction without altering phosphorylation of MDC1 by ATM.
26551349 This study showed that UCA1 and WRAP53 upregulation may serve as novel serum biomarkers for hepatocellular carcinoma diagnosis and prognosis.
26460974 the sub-cellular localization of the WRAP53 protein has a significant impact on breast cancer survival.
26426684 Moreover, our current observations identify the nuclear levels of WRAP53beta as a promising biomarker for the survival of patients with ovarian cancer.
26170453 The telomerase holoenzyme Cajal body-associated protein, TCAB1, was released from telomerase RNA in mitotic cells coincident with TCAB1 delocalization from Cajal bodies.
25854392 Decreasing the expression of WRAP53 using RNA interference technique can enhance the radiosensitivity.
25512560 WRAP53beta as a novel regulator of DSB repair by providing a scaffold for DNA repair factors.
25467444 Study finds that TRiC is required for folding the telomerase cofactor TCAB1, which controls trafficking of telomerase and small Cajal body RNAs (scaRNAs).
25456005 nuclear expression of WRAP53beta promotes tumor cell death in response to radiotherapy and is a promising predictor of radiotherapy response in patients with HNSCC
25134915 Studied the association of a frequent genetic variation in WRAP53, rs2287499 (C/G), with breast cancer risk and prognosis among Iranian-Azeri population.
More...

AA Sequence

MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREG      1 - 70
DPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAED     71 - 140
EGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVE    141 - 210
YAEMVPVLRMVEGDTIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA    211 - 280
HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLG    281 - 350
LYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD    351 - 420
LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE    421 - 490
SGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGVGELI                491 - 548
//

Publication (52)

PMID Year Title
26734725 2015 The proximity ligation assay reveals that at DNA double-strand breaks WRAP53? associates with ?H2AX and controls interactions between RNF8 and MDC1.
26551349 2016 Investigation of long noncoding RNAs expression profile as potential serum biomarkers in patients with hepatocellular carcinoma.
26460974 2015 The Sub-Cellular Localization of WRAP53 Has Prognostic Impact in Breast Cancer.
26426684 2015 Downregulation of the cancer susceptibility protein WRAP53? in epithelial ovarian cancer leads to defective DNA repair and poor clinical outcome.
26170453 2015 Dynamics of Human Telomerase Holoenzyme Assembly and Subunit Exchange across the Cell Cycle.
25854392 2015 Regulatory effects of WRAP53 on radiosensitivity of laryngeal squamous cell carcinoma cells.
25512560 2014 The scaffold protein WRAP53? orchestrates the ubiquitin response critical for DNA double-strand break repair.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25456005 2015 Nuclear expression of WRAP53? is associated with a positive response to radiotherapy and improved overall survival in patients with head and neck squamous cell carcinoma.
25134915 2014 Single-strand conformational polymorphism analysis of a common single nucleotide variation in WRAP53 gene, rs2287499, and evaluating its association in relation to breast cancer risk and prognosis among Iranian-Azeri population.
More...