Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.61
PubTator Score 10.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.100 5.6e-03
oligodendroglioma 1.200 1.9e-02
ovarian cancer 1.400 2.1e-05
psoriasis 1.400 6.0e-05

Gene RIF (4)

AA Sequence

MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAER      1 - 70
ERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQ     71 - 140
PLSLEELLAKKKAEEEAEAKPKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQ    141 - 210
ERERRERRERMERETNGNEDEEGRQKIREEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASE    211 - 280
DTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQ    281 - 350
RWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVIDKCGYKEPTPIQRQ    351 - 420
AIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIK    421 - 490
FGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFE    491 - 560
PDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIG    561 - 630
SAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQ    631 - 700
EQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTK    701 - 770
EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA                        771 - 820
//

Text Mined References (27)

PMID Year Title