Property Summary

NCBI Gene PubMed Count 58
PubMed Score 59.36
PubTator Score 53.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.347 2.8e-06
adult high grade glioma -1.300 9.9e-03
astrocytic glioma -1.400 1.8e-03
atypical teratoid / rhabdoid tumor -1.700 1.4e-03
Breast cancer 1.200 1.3e-04
colon cancer -1.600 4.4e-02
cystic fibrosis 1.008 6.8e-05
dermatomyositis 1.200 4.2e-03
ependymoma -1.300 3.1e-02
group 3 medulloblastoma -1.100 3.5e-02
intraductal papillary-mucinous adenoma (... 1.200 5.5e-04
intraductal papillary-mucinous carcinoma... 1.200 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.8e-03
invasive ductal carcinoma 1.200 1.2e-02
lung cancer -2.700 4.6e-06
medulloblastoma, large-cell -1.800 4.6e-04
Multiple myeloma 1.272 8.3e-05
oligodendroglioma -1.400 3.0e-03
ovarian cancer 1.700 6.6e-03
pituitary cancer -1.600 2.7e-07
primitive neuroectodermal tumor -1.100 3.1e-02

Protein-protein Interaction (3)

Gene RIF (44)

AA Sequence

MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV      1 - 70
DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN     71 - 140
FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAM    141 - 210
LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP                                          211 - 242
//

Text Mined References (64)

PMID Year Title