Property Summary

NCBI Gene PubMed Count 55
PubMed Score 56.42
PubTator Score 53.26

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
Liver carcinoma 217
Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.79383105245359E-9
pituitary cancer 1972 3.35067100814697E-7
group 4 medulloblastoma 1875 8.47853497939943E-7
acute quadriplegic myopathy 1157 2.83829372100121E-6
lung cancer 4473 3.67443722692457E-6
cystic fibrosis 1670 2.77372250066915E-5
Multiple myeloma 1328 8.26041304160118E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 8.31788113006219E-5
atypical teratoid / rhabdoid tumor 4369 1.21366073240643E-4
Breast cancer 3099 1.30767349690103E-4
medulloblastoma, large-cell 6234 3.4608491083567E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.42985380648511E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.43066377658571E-4
dermatomyositis 967 0.00423041371690621
ovarian cancer 8492 0.00657553680695654
astrocytic glioma 2241 0.00665342517525843
adult high grade glioma 2148 0.00989156968902994
invasive ductal carcinoma 2950 0.0124433309013416
oligodendroglioma 2849 0.0210011168452047
primitive neuroectodermal tumor 3031 0.0313005402364679
colon cancer 1475 0.0440379994441611
Disease Target Count Z-score Confidence
Cancer 2346 3.237 1.6



Accession Q9BUP3 A8K7S7 D3DQY8 O15383 O60520 O95345 Q53GC1 Q53GG2 Q6IBI3
Symbols CC3




  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Pathway (1)

Gene RIF (41)

26752068 combination of sorafenib and metformin inhibits proliferation and invasion in vitro, prolongs median survival, and reduces lung metastasis of HCC in vivo. This effect is closely associated with the upregulation of TIP30
26718891 The results of the present study indicated that TIP30 may suppress oncogenesis and glioma progression, thereby improving the prognosis of patients with glioma.
26362536 HIV-1 Gag interacts with HTATIP2 as demonstrated by proximity dependent biotinylation proteomics
25986235 Increased HMGB1 and cleaved caspase-3 stimulate the proliferation of tumor cells and are correlated with the poor prognosis in colorectal cancer
25688879 Meta-analysis suggests that the rs2230199 C/G, rs1047286 C/T, rs11569536 G/A and rs2250656 A/G SNPs in the CC3 gene may be associated with age-related macular degeneration risk.
25617528 the present study showed that loss of HTATIP2 expression was a frequent event in glioma and is associated with poor prognosis.
25544767 Data iindicate TIP30 was a marker in predicting the prognosis of esophageal squamous cell carcinoma (ESCC).
25135222 TIP30-induced downregulation of cyclin D1 transcription antagonizes EGFR signaling and suppresses tumorigenesis
25008315 The combination of HTATIP2 and MVD predicts the converse survival of HCC with or without sorafenib intervention.
24681951 The results suggest a novel and critical role of TIP30 involved in hepatocellular carcinoma progression and aggressiveness.

AA Sequence

LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP                                          211 - 242

Text Mined References (61)

PMID Year Title
26752068 2016 Metformin inhibits the prometastatic effect of sorafenib in hepatocellular carcinoma by upregulating the expression of TIP30.
26718891 2016 Overexpression of TIP30 inhibits the growth and invasion of glioma cells.
25986235 2015 Increased HMGB1 and cleaved caspase-3 stimulate the proliferation of tumor cells and are correlated with the poor prognosis in colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25688879 2015 Nonsynonymous single nucleotide polymorphisms in the complement component 3 gene are associated with risk of age-related macular degeneration: a meta-analysis.
25617528 2015 Downregulation of HTATIP2 expression is associated with promoter methylation and poor prognosis in glioma.
25544767 2015 TGF-?1 induces epigenetic silence of TIP30 to promote tumor metastasis in esophageal carcinoma.
25135222 2014 TIP30 nuclear translocation negatively regulates EGF-dependent cyclin D1 transcription in human lung adenocarcinoma.
25008315 2014 The combination of HTATIP2 expression and microvessel density predicts converse survival of hepatocellular carcinoma with or without sorafenib.
24681951 2015 Decreased TIP30 promotes Snail-mediated epithelial-mesenchymal transition and tumor-initiating properties in hepatocellular carcinoma.