Property Summary

NCBI Gene PubMed Count 55
Grant Count 19
R01 Count 16
Funding $2,612,293.81
PubMed Score 56.42
PubTator Score 53.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (42)

PMID Text
26752068 combination of sorafenib and metformin inhibits proliferation and invasion in vitro, prolongs median survival, and reduces lung metastasis of HCC in vivo. This effect is closely associated with the upregulation of TIP30
26718891 The results of the present study indicated that TIP30 may suppress oncogenesis and glioma progression, thereby improving the prognosis of patients with glioma.
26362536 HIV-1 Gag interacts with HTATIP2 as demonstrated by proximity dependent biotinylation proteomics
25986235 Increased HMGB1 and cleaved caspase-3 stimulate the proliferation of tumor cells and are correlated with the poor prognosis in colorectal cancer
25688879 Meta-analysis suggests that the rs2230199 C/G, rs1047286 C/T, rs11569536 G/A and rs2250656 A/G SNPs in the CC3 gene may be associated with age-related macular degeneration risk.
25617528 the present study showed that loss of HTATIP2 expression was a frequent event in glioma and is associated with poor prognosis.
25544767 Data iindicate TIP30 was a marker in predicting the prognosis of esophageal squamous cell carcinoma (ESCC).
25135222 TIP30-induced downregulation of cyclin D1 transcription antagonizes EGFR signaling and suppresses tumorigenesis
25008315 The combination of HTATIP2 and MVD predicts the converse survival of HCC with or without sorafenib intervention.
24681951 The results suggest a novel and critical role of TIP30 involved in hepatocellular carcinoma progression and aggressiveness.
More...

AA Sequence

MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV      1 - 70
DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN     71 - 140
FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAM    141 - 210
LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP                                          211 - 242
//

Publication (61)

PMID Year Title
26752068 2016 Metformin inhibits the prometastatic effect of sorafenib in hepatocellular carcinoma by upregulating the expression of TIP30.
26718891 2016 Overexpression of TIP30 inhibits the growth and invasion of glioma cells.
25986235 2015 Increased HMGB1 and cleaved caspase-3 stimulate the proliferation of tumor cells and are correlated with the poor prognosis in colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25688879 2015 Nonsynonymous single nucleotide polymorphisms in the complement component 3 gene are associated with risk of age-related macular degeneration: a meta-analysis.
25617528 2015 Downregulation of HTATIP2 expression is associated with promoter methylation and poor prognosis in glioma.
25544767 2015 TGF-?1 induces epigenetic silence of TIP30 to promote tumor metastasis in esophageal carcinoma.
25135222 2014 TIP30 nuclear translocation negatively regulates EGF-dependent cyclin D1 transcription in human lung adenocarcinoma.
25008315 2014 The combination of HTATIP2 expression and microvessel density predicts converse survival of hepatocellular carcinoma with or without sorafenib.
24681951 2015 Decreased TIP30 promotes Snail-mediated epithelial-mesenchymal transition and tumor-initiating properties in hepatocellular carcinoma.
More...