Property Summary

NCBI Gene PubMed Count 48
PubMed Score 60.38
PubTator Score 74.01

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BUN8 B3KW41 E9PH19
Symbols DER1
DER-1
derlin-1

Gene

PANTHER Protein Class (1)

Gene RIF (21)

PMID Text
26173415 Results showed that Derlin-1 is overexpressed in colon cancer and promotes proliferation of colon cancer cells.
25030448 TMEM129 contains an unusual cysteine-only RING with intrinsic E3 ligase activity and is recruited to US11 via Derlin-1.
24089527 Cav-1 may be a cofactor in the interaction of Derlin-1 and N-glycosylated COX-2 and may facilitate Derlin-1- and p97 complex-mediated COX-2 ubiquitination, retrotranslocation, and degradation.
23306155 Derlin-1 is overexpressed in non-small cell lung cancer and promotes invasion by EGFR-ERK-mediated up-regulation of MMP-2 and MMP-9.
22627700 Upregulation of derlin-1 may be associated with endoplasmic reticulum stress in neuronal cells in Alzheimer's disease.
22311976 Derlin-1 expression levels may affect glucose-stimulated insulin secretion by altering surface expression of K(ATP) channels.
22238364 These results indicate that ApoB after lipidation is dislocated from the ER lumen to the LD surface for proteasomal degradation and that Derlin-1 and UBXD8 are engaged in the predislocation and postdislocation steps, respectively.
21184741 Derlin-1 is a negative regulator for both glycosylated and non-glycosylated BCRP expression and provide a novel posttranslational regulatory mechanism of BCRP by Derlin-1.
19114714 Derlin-1 did not modify KCNQ1 expression level, and no interaction between endogenous KCNQ1 and Derlin-1 could be detected.
18927294 Overexpression of DERL1 is associated with neoplasms
More...

AA Sequence

MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGF      1 - 70
LYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDM     71 - 140
IVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWL    141 - 210
PSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ                                 211 - 251
//

Text Mined References (55)

PMID Year Title
26173415 2015 Derlin-1 is overexpressed in human colon cancer and promotes cancer cell proliferation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25416956 2014 A proteome-scale map of the human interactome network.
25239945 2014 Signal peptide peptidase functions in ERAD to cleave the unfolded protein response regulator XBP1u.
25030448 2014 TMEM129 is a Derlin-1 associated ERAD E3 ligase essential for virus-induced degradation of MHC-I.
24089527 2013 Caveolin-1 interacts with Derlin-1 and promotes ubiquitination and degradation of cyclooxygenase-2 via collaboration with p97 complex.
24019521 2013 RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).
23306155 2013 Derlin-1 is overexpressed in non-small cell lung cancer and promotes cancer cell invasion via EGFR-ERK-mediated up-regulation of MMP-2 and MMP-9.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...