Property Summary

NCBI Gene PubMed Count 56
PubMed Score 69.72
PubTator Score 74.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 3.100 2.5e-02
glioblastoma 1.300 3.6e-03
intraductal papillary-mucinous carcinoma... 1.100 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.100 9.1e-04
juvenile dermatomyositis 1.125 3.0e-11
Multiple myeloma 1.128 5.4e-03
ovarian cancer 1.600 3.7e-03
pancreatic ductal adenocarcinoma liver m... -1.337 1.2e-03
psoriasis -1.400 3.2e-04

Gene RIF (27)

AA Sequence

MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGF      1 - 70
LYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDM     71 - 140
IVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWL    141 - 210
PSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ                                 211 - 251
//

Text Mined References (63)

PMID Year Title