Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.91
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Bardet-Biedl syndrome 1 22 0.0 0.0
Disease Target Count P-value
acute quadriplegic myopathy 1158 6.2e-06
group 3 medulloblastoma 4104 5.4e-03
psoriasis 6694 6.8e-03
Disease Target Count Z-score Confidence
Bardet-Biedl syndrome 51 5.243 2.6
Obesity 678 0.0 4.0
Disease Target Count Z-score Confidence
Ciliopathy 71 4.916 2.5
Congenital nystagmus 26 3.617 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy -1.480 6.2e-06
group 3 medulloblastoma 1.100 5.4e-03
psoriasis 1.100 6.8e-03

Gene RIF (4)

AA Sequence

MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGS      1 - 70
GSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCG     71 - 140
EEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA              141 - 200
//

Text Mined References (17)

PMID Year Title