Property Summary

NCBI Gene PubMed Count 4
PubMed Score 71.74
PubTator Score 57.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 7.16420201168784E-12
atypical teratoid / rhabdoid tumor 4369 1.00624620196345E-6
malignant mesothelioma 3163 9.2553413801602E-6
osteosarcoma 7933 1.30882622247612E-5
glioblastoma 5572 6.0092984182084E-5
group 3 medulloblastoma 2254 7.29769721329801E-5
medulloblastoma, large-cell 6234 2.03996608260365E-4
primitive neuroectodermal tumor 3031 3.01783314893274E-4
ductal carcinoma in situ 1745 6.62813860446103E-4
invasive ductal carcinoma 2950 0.0115609299342307
spina bifida 1064 0.0226439600247717
Breast cancer 3099 0.0238613804174489

Expression

  Differential Expression (12)

Synonym

Accession Q9BUN1 B2RDU8 Q9NWZ4
Symbols MENT

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
24094886 DNMT3B7 overexpression might interfere with the normal DNA methylation mechanism required for silencing the MENT proto-oncogene, and may accelerate human lymphomagenesis.

AA Sequence

MVPAAGALLWVLLLNLGPRAAGAQGLTQTPTEMQRVSLRFGGPMTRSYRSTARTGLPRKTRIILEDENDA      1 - 70
MADADRLAGPAAAELLAATVSTGFSRSSAINEEDGSSEEGVVINAGKDSTSRELPSATPNTAGSSSTRFI     71 - 140
ANSQEPEIRLTSSLPRSPGRSTEDLPGSQATLSQWSTPGSTPSRWPSPSPTAMPSPEDLRLVLMPWGPWH    141 - 210
CHCKSGTMSRSRSGKLHGLSGRLRVGALSQLRTEHKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTT    211 - 280
STRTTTTPFPTIHLRSSPSLPPASPCPALAFWKRVRIGLEDIWNSLSSVFTEMQPIDRNQR             281 - 341
//

Text Mined References (7)

PMID Year Title
24094886 2013 DNMT3B7 expression related to MENT expression and its promoter methylation in human lymphomas.
22133874 2012 Loss of Dnmt3b function upregulates the tumor modifier Ment and accelerates mouse lymphomagenesis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.