Property Summary

NCBI Gene PubMed Count 4
PubMed Score 72.74
PubTator Score 57.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.0e-06
Breast cancer 2.600 2.4e-02
ductal carcinoma in situ 1.600 6.6e-04
ependymoma 1.600 4.5e-13
glioblastoma 1.300 6.0e-05
group 3 medulloblastoma 1.200 3.8e-03
invasive ductal carcinoma 1.500 1.2e-02
malignant mesothelioma -1.100 9.3e-06
medulloblastoma, large-cell 1.400 2.0e-04
osteosarcoma -1.398 1.3e-05
primitive neuroectodermal tumor 1.400 3.0e-04
spina bifida -1.391 3.1e-02

Gene RIF (1)

AA Sequence

MVPAAGALLWVLLLNLGPRAAGAQGLTQTPTEMQRVSLRFGGPMTRSYRSTARTGLPRKTRIILEDENDA      1 - 70
MADADRLAGPAAAELLAATVSTGFSRSSAINEEDGSSEEGVVINAGKDSTSRELPSATPNTAGSSSTRFI     71 - 140
ANSQEPEIRLTSSLPRSPGRSTEDLPGSQATLSQWSTPGSTPSRWPSPSPTAMPSPEDLRLVLMPWGPWH    141 - 210
CHCKSGTMSRSRSGKLHGLSGRLRVGALSQLRTEHKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTT    211 - 280
STRTTTTPFPTIHLRSSPSLPPASPCPALAFWKRVRIGLEDIWNSLSSVFTEMQPIDRNQR             281 - 341
//

Text Mined References (7)

PMID Year Title