Property Summary

NCBI Gene PubMed Count 37
PubMed Score 37.16
PubTator Score 78.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.700 1.5e-03
Astrocytoma, Pilocytic 1.300 9.8e-06
atypical teratoid / rhabdoid tumor 1.900 2.3e-08
ependymoma 1.100 9.8e-03
glioblastoma 1.200 1.6e-02
group 4 medulloblastoma 1.200 6.8e-04
lung cancer 1.400 3.7e-03
medulloblastoma, large-cell 1.600 1.1e-04
osteosarcoma 1.473 1.4e-04
ovarian cancer 1.100 1.8e-05
pediatric high grade glioma 1.100 2.8e-04
Rheumatoid arthritis -1.400 1.6e-02
subependymal giant cell astrocytoma 1.499 2.1e-02

Gene RIF (31)

AA Sequence

MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWISLITEWLNLI      1 - 70
FKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVATRARSR     71 - 140
WVRVMPSLAYCTFLLAVGLSRIFILAHFPHQVLAGLITGAVLGWLMTPRVPMERELSFYGLTALALMLGT    141 - 210
SLIYWTLFTLGLDLSWSISLAFKWCERPEWIHVDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGN    211 - 280
GQKIACLVLAMGLLGPLDWLGHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS        281 - 346
//

Text Mined References (41)

PMID Year Title