Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.57
PubTator Score 9.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 3.6e-03
astrocytic glioma -1.100 2.0e-02
atypical teratoid / rhabdoid tumor -1.100 2.3e-03
COPD -1.100 8.0e-03
ependymoma -1.400 5.5e-03
lung cancer 1.200 1.1e-02
malignant mesothelioma 4.200 8.6e-09
oligodendroglioma -1.300 6.6e-03
Rheumatoid arthritis -1.100 2.1e-02

Gene RIF (3)

AA Sequence

MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGC      1 - 70
GRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLS     71 - 140
KDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA               141 - 199
//

Text Mined References (17)

PMID Year Title