Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.39
PubTator Score 9.13

Knowledge Summary

Patent

No data available

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
23587095 Rpp25 is a major target of autoantibodies to the Th/To autoantigen complex
20632321 Taken together, these findings suggest a potential role for the RPP25 gene transcript in the neurobiology of developmental brain disorders.
20215441 analyses of interactions with deletion mutant proteins indicate that the Alba-type core domain of both Rpp20 and Rpp25 contains most of the determinants for mutual association and P3 RNA recognition.

AA Sequence

MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGC      1 - 70
GRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLS     71 - 140
KDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA               141 - 199
//

Text Mined References (16)

PMID Year Title
23587095 2013 Rpp25 is a major target of autoantibodies to the Th/To complex as measured by a novel chemiluminescent assay.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20632321 2010 RPP25 is developmentally regulated in prefrontal cortex and expressed at decreased levels in autism spectrum disorder.
20215441 2010 Heterodimerization of the human RNase P/MRP subunits Rpp20 and Rpp25 is a prerequisite for interaction with the P3 arm of RNase MRP RNA.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...