Property Summary

NCBI Gene PubMed Count 75
Grant Count 68
R01 Count 38
Funding $3,402,351.92
PubMed Score 74.12
PubTator Score 83.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.411 0.016
Multiple myeloma 1.111 0.028
psoriasis 1.400 0.000
hereditary spastic paraplegia -1.072 0.004
lung cancer 1.600 0.000

Synonym

Accession Q9BUL8 A8K515 D3DNN5 O14811
Symbols CCM3
TFAR15

Gene

PDB

3AJM   3L8I   3L8J   3RQE   3RQF   3RQG   3W8H   3W8I   4GEH   4TVQ  

Gene RIF (56)

PMID Text
26771762 The proto-oncogene PDCD10 is direct target of miR-103 that can suppress Prostate cancer proliferation and migration by down-regulating the PDCD10.
26490252 We report for the first time that PDCD10 expression is downregulated in GBM, which is associated with the activation of Akt signaling protein
26385474 Study highlights the potential role of CCM3 in regulating tight junction complex organization and brain endothelial barrier permeability through CCM3-ERK1/2-cortactin cross-talk
26356566 Studies suggest that the 3 proteins of the Cerebral Cavernous Malformations (CCM) complex KRIT1/CCM1, CCM2/malcavernin and CCM3/PDCD10 not only require one another for reciprocal stabilization, but also act as a platform for signal transduction.
26246098 A causative mutation in the PDCD10 gene (p.Gln112PhefsX13) was identified in an Italian family with cerebral cavernous malformations associated with meningioma.
26115622 A novel CCM3 missense mutation (c.422T>G) detected in 2 Greek brothers with cerebral cavernous malformations causes a loss of function in Pdcd10 protein due to its localization in the 8th helix. It affects Leu141. It may play a role in angiogenesis.
25872572 miR-181b was upregulated by hypoxia in retinoblastoma in an HIF-1a-independent manner. Additionally, miR-181b exerts its angiogenic function, at least in part, by inhibiting PDCD10 and GATA6.
25825518 both CCM2 and CCM3 are required for normal endothelial cell network formation.
25655101 Results broaden our knowledge on the mechanisms by which CCM3 deficiency results in disease and open new avenues of research into both CCM3 and senescence biology.
25550858 Our results suggest that MST4, STK25 and PDCD10 are upregulated in prostate cancer and may play roles in prostate tumorigenesis.
More...

AA Sequence

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK      1 - 70
SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE     71 - 140
LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT    141 - 210
VA                                                                        211 - 212
//

Text Mined References (79)

PMID Year Title
26771762 2016 MicroRNA-103 suppresses tumor cell proliferation by targeting PDCD10 in prostate cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26490252 2015 Downregulation of programmed cell death 10 is associated with tumor cell proliferation, hyperangiogenesis and peritumoral edema in human glioblastoma.
26385474 2015 PDCD10 (CCM3) regulates brain endothelial barrier integrity in cerebral cavernous malformation type 3: role of CCM3-ERK1/2-cortactin cross-talk.
26356566 2015 The cerebral cavernous malformations proteins.
26246098 2015 Cerebral cavernous malformations associated to meningioma: High penetrance in a novel family mutated in the PDCD10 gene.
26115622 2015 Detection of Novel Mutation in Ccm3 Causes Familial Cerebral Cavernous Malformations.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25872572 2015 Hypoxia-induced miR-181b enhances angiogenesis of retinoblastoma cells by targeting PDCD10 and GATA6.
25825518 2015 CCM2-CCM3 interaction stabilizes their protein expression and permits endothelial network formation.
More...