Property Summary

NCBI Gene PubMed Count 81
PubMed Score 37.17
PubTator Score 83.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
hereditary spastic paraplegia -1.072 4.0e-03
lung cancer 1.400 1.1e-02
Multiple myeloma 1.111 2.8e-02
psoriasis 1.400 7.3e-05
Waldenstrons macroglobulinemia 1.411 1.6e-02

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (60)

AA Sequence

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK      1 - 70
SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE     71 - 140
LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT    141 - 210
VA                                                                        211 - 212
//

Text Mined References (86)

PMID Year Title