Property Summary

NCBI Gene PubMed Count 13
PubMed Score 18.25
PubTator Score 4.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 3.7e-03
atypical teratoid / rhabdoid tumor -1.400 3.1e-05
dermatomyositis 1.100 2.8e-04
group 3 medulloblastoma -1.200 6.0e-03
lung adenocarcinoma -1.200 2.6e-08
malignant mesothelioma -1.600 3.0e-07
medulloblastoma, large-cell -1.700 2.1e-05
osteosarcoma -1.117 3.8e-03
ovarian cancer 1.900 1.7e-04
primitive neuroectodermal tumor -1.100 5.5e-03

Gene RIF (5)

AA Sequence

MPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTA      1 - 70
AERDEILRAVGNMPY                                                            71 - 85
//

Text Mined References (14)

PMID Year Title