Property Summary

NCBI Gene PubMed Count 13
Grant Count 10
R01 Count 9
Funding $532,261.62
PubMed Score 16.59
PubTator Score 4.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
osteosarcoma -1.117 0.004
group 4 medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.100 0.005
adult high grade glioma -1.300 0.004
lung adenocarcinoma -1.200 0.000
ovarian cancer 1.900 0.000
dermatomyositis 1.100 0.000

Gene RIF (5)

PMID Text
22842048 Molecular interactions guiding the protein recognition between Mia40 and the disulfide-reduced CHCHD5 and CHCHD7.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
16736500 CHCHD7 is a newly identified member of a ubiquitously expressed multifamily of proteins containing a conserved (coiled coil 1)-(helix 1)-(coiled coil 2)-(helix 2) domain; it has not been previously associated with neoplasia.

AA Sequence

MPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTA      1 - 70
AERDEILRAVGNMPY                                                            71 - 85
//

Publication (14)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
22842048 2012 Structural characterization of CHCHD5 and CHCHD7: two atypical human twin CX9C proteins.
20922212 2010 Genome-wide analysis of eukaryotic twin CX9C proteins.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
16736500 2006 CHCHD7-PLAG1 and TCEA1-PLAG1 gene fusions resulting from cryptic, intrachromosomal 8q rearrangements in pleomorphic salivary gland adenomas.
16421571 2006 DNA sequence and analysis of human chromosome 8.
More...