Property Summary

NCBI Gene PubMed Count 41
PubMed Score 11.28
PubTator Score 14.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.500 5.6e-03
atypical teratoid / rhabdoid tumor 2.000 1.6e-06
ependymoma 2.100 1.1e-03
glioblastoma 2.000 6.1e-07
group 4 medulloblastoma 2.000 2.5e-05
medulloblastoma, large-cell 2.300 5.7e-05
oligodendroglioma 1.600 2.7e-03
osteosarcoma -1.053 1.6e-03
pediatric high grade glioma 1.300 6.0e-05
primitive neuroectodermal tumor 1.800 1.4e-05
psoriasis -1.800 1.3e-04

Gene RIF (18)

AA Sequence

MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGS      1 - 70
ELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPE     71 - 140
MKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTL    141 - 210
VAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPH    211 - 280
VVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGK    281 - 350
WMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE    351 - 420
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNR    421 - 490
LIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLE    491 - 560
MKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYE    561 - 630
NRGPPGGNRGGFQNRGGGSGGGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQ    631 - 700
PPPPQPPPQQPPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQG    701 - 770
YTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY    771 - 840
DYGSYSGNTQGGTSTQ                                                          841 - 856
//

Text Mined References (61)

PMID Year Title