Property Summary

NCBI Gene PubMed Count 40
PubMed Score 11.11
PubTator Score 14.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma 5572 6.0944240679374E-7
atypical teratoid / rhabdoid tumor 4369 1.64765198638447E-6
primitive neuroectodermal tumor 3031 1.3817162491859E-5
medulloblastoma 1524 2.1316048758657E-5
medulloblastoma, large-cell 6234 5.74336866679291E-5
pediatric high grade glioma 2712 6.03605343585074E-5
psoriasis 6685 1.327379570382E-4
ependymoma 2514 0.0011464295542938
astrocytoma 1493 0.00158208988281643
osteosarcoma 7933 0.00164469736443361
oligodendroglioma 2849 0.00270796233061267

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.600 0.002
ependymoma 2.100 0.001
oligodendroglioma 1.600 0.003
psoriasis -1.800 0.000
osteosarcoma -1.053 0.002
medulloblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
glioblastoma 2.000 0.000
medulloblastoma, large-cell 2.300 0.000
primitive neuroectodermal tumor 1.800 0.000
pediatric high grade glioma 1.300 0.000

Synonym

Accession Q9BUJ2 B3KMW7 O76022 Q6ZSZ0 Q7L8P4 Q8N6Z4 Q96G37 Q9HAL3 Q9UG75
Symbols E1BAP5
E1B-AP5
HNRPUL1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (18)

PMID Text
26020839 we define the arginines within the RGG/RG motifs as the site of methylation by PRMT1 both in vitro and in vivo. The arginines within the human hnRNPUL1 RGG/RG motifs were substituted with lysines to generate hnRNPUL1(RK).
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that HNRNPUL1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with HNRNPUL1
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that HNRNPUL1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with HNRNPUL1
24595077 Despite the limitations, hnRPUL1 and PARP1 were downregulated in renal cell carcinoma and connected with the prognosis.
23577092 hnRPUL1 as a new component related to PARP1 in DNA damage response and repair
22451911 U7 snRNP represses histone gene transcription under cell cycle-arrested conditions. hnRNP UL1 is responsible for U7 snRNP-dependent transcriptional repression of replication-dependent histone genes.
22365830 hnRNPUL1 and -2 function downstream of MRN and CtBP-interacting protein (CtIP) to promote recruitment of the BLM helicase to DNA breaks.
21083500 E1B-AP5 is a novel surface molecule that is involved in the undifferentiated state of human embryonic stem cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGS      1 - 70
ELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPE     71 - 140
MKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTL    141 - 210
VAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPH    211 - 280
VVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGK    281 - 350
WMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE    351 - 420
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNR    421 - 490
LIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLE    491 - 560
MKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYE    561 - 630
NRGPPGGNRGGFQNRGGGSGGGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQ    631 - 700
PPPPQPPPQQPPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQG    701 - 770
YTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY    771 - 840
DYGSYSGNTQGGTSTQ                                                          841 - 856
//

Text Mined References (59)

PMID Year Title
26020839 2015 Arginine methylation of hnRNPUL1 regulates interaction with NBS1 and recruitment to sites of DNA damage.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24595077 2013 Heterogeneous nuclear ribonucleoprotein U-like 1 and Poly (ADP-ribose) polymerase 1 are downregulated in renal cell carcinoma and connected with the prognosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...