Property Summary

NCBI Gene PubMed Count 40
Grant Count 6
R01 Count 6
Funding $175,496.22
PubMed Score 11.11
PubTator Score 14.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.600 0.002
ependymoma 2.100 0.001
oligodendroglioma 1.600 0.003
psoriasis -1.800 0.000
osteosarcoma -1.053 0.002
medulloblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
glioblastoma 2.000 0.000
medulloblastoma, large-cell 2.300 0.000
primitive neuroectodermal tumor 1.800 0.000
pediatric high grade glioma 1.300 0.000

Gene RIF (18)

PMID Text
26020839 we define the arginines within the RGG/RG motifs as the site of methylation by PRMT1 both in vitro and in vivo. The arginines within the human hnRNPUL1 RGG/RG motifs were substituted with lysines to generate hnRNPUL1(RK).
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that HNRNPUL1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with HNRNPUL1
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that HNRNPUL1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with HNRNPUL1
24595077 Despite the limitations, hnRPUL1 and PARP1 were downregulated in renal cell carcinoma and connected with the prognosis.
23577092 hnRPUL1 as a new component related to PARP1 in DNA damage response and repair
22451911 U7 snRNP represses histone gene transcription under cell cycle-arrested conditions. hnRNP UL1 is responsible for U7 snRNP-dependent transcriptional repression of replication-dependent histone genes.
22365830 hnRNPUL1 and -2 function downstream of MRN and CtBP-interacting protein (CtIP) to promote recruitment of the BLM helicase to DNA breaks.
21083500 E1B-AP5 is a novel surface molecule that is involved in the undifferentiated state of human embryonic stem cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGS      1 - 70
ELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPE     71 - 140
MKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTL    141 - 210
VAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPH    211 - 280
VVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGK    281 - 350
WMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE    351 - 420
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNR    421 - 490
LIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLE    491 - 560
MKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYE    561 - 630
NRGPPGGNRGGFQNRGGGSGGGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQ    631 - 700
PPPPQPPPQQPPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQG    701 - 770
YTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY    771 - 840
DYGSYSGNTQGGTSTQ                                                          841 - 856
//

Publication (59)

PMID Year Title
26020839 2015 Arginine methylation of hnRNPUL1 regulates interaction with NBS1 and recruitment to sites of DNA damage.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24595077 2013 Heterogeneous nuclear ribonucleoprotein U-like 1 and Poly (ADP-ribose) polymerase 1 are downregulated in renal cell carcinoma and connected with the prognosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...