Property Summary

NCBI Gene PubMed Count 7
PubMed Score 11.42
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Werner syndrome 29 4.228 2.1

Expression

Synonym

Accession Q9BUH6 Q8IY19
Symbols XLS
PAXX

Gene

PDB

3WTD   3WTF   4WJA  

Gene RIF (2)

PMID Text
25670504 These data identify PAXX as a new Non-homologous end joining factor.
25574025 PAXX promotes Ku-dependent DNA ligation in vitro and assembly of core nonhomologous end-joining (NHEJ) factors on damaged chromatin in cells. These findings identify PAXX as a new component of the NHEJ machinery.

AA Sequence

MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAE      1 - 70
DITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLA     71 - 140
AAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET          141 - 204
//

Publication (19)

PMID Year Title
25941166 2015 XLS (c9orf142) is a new component of mammalian DNA double-stranded break repair.
25670504 2015 Interactome analysis identifies a new paralogue of XRCC4 in non-homologous end joining DNA repair pathway.
25574025 2015 DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...