Property Summary

NCBI Gene PubMed Count 8
PubMed Score 28.08
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q9BUH6 Q8IY19
Symbols XLS
C9orf142

Gene

PDB

3WTD   3WTF   4WJA  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAE      1 - 70
DITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLA     71 - 140
AAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET          141 - 204
//

Text Mined References (20)

PMID Year Title