Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.68324230802916E-12
malignant mesothelioma 3163 9.66226106174304E-8
atypical teratoid / rhabdoid tumor 4369 1.41729789408639E-5
osteosarcoma 7933 2.85748505704147E-4

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
osteosarcoma -1.239 0.000
posterior fossa group B ependymoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000

Synonym

Accession Q9BUG6 B4DX98 Q49A73 Q53F04 Q8N7B3
Symbols ZNF495
ZSCAN5

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Horse OMA EggNOG

AA Sequence

MAANCTSSWSLGESCNRPGLELPRSMASSETQLGNHDVDPEISHVNFRMFSCPKESDPIQALRKLTELCH      1 - 70
LWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVMMNGVQSCKDLEDLLRNNRRPKKWSVVTFHGKEYIV     71 - 140
QDSDIEMAEAPSSVRDDLKDVSSQRASSVNQMRPGEGQAHRELQILPRVPALSRRQGEDFLLHKSIDVTG    141 - 210
DPKSLRPKQTLEKDLKENREENPGLTSPEPQLPKSPTDLVRAKEGKDPPKIASVENVDADTPSACVVERE    211 - 280
ASTHSGNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNSIHSPGPASPVSHPDGQEA    281 - 350
KALPPFACDVCEKRFTCNSKLVIHKRSHTGERLFQCNLCGKRFMQLISLQFHQRTHTGERPYTCDVCQKQ    351 - 420
FTQKSYLKCHKRSHTGEKPFECKDCKKVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLKLLRRHQKTH    421 - 490
PEATSQ                                                                    491 - 496
//

Text Mined References (6)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.