Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 9.0e-13
malignant mesothelioma 3232 9.7e-08
atypical teratoid / rhabdoid tumor 5112 1.4e-05
osteosarcoma 7950 2.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.4e-05
ependymoma 1.400 9.0e-13
malignant mesothelioma 2.200 9.7e-08
osteosarcoma -1.239 2.9e-04

AA Sequence

MAANCTSSWSLGESCNRPGLELPRSMASSETQLGNHDVDPEISHVNFRMFSCPKESDPIQALRKLTELCH      1 - 70
LWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVMMNGVQSCKDLEDLLRNNRRPKKWSVVTFHGKEYIV     71 - 140
QDSDIEMAEAPSSVRDDLKDVSSQRASSVNQMRPGEGQAHRELQILPRVPALSRRQGEDFLLHKSIDVTG    141 - 210
DPKSLRPKQTLEKDLKENREENPGLTSPEPQLPKSPTDLVRAKEGKDPPKIASVENVDADTPSACVVERE    211 - 280
ASTHSGNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNSIHSPGPASPVSHPDGQEA    281 - 350
KALPPFACDVCEKRFTCNSKLVIHKRSHTGERLFQCNLCGKRFMQLISLQFHQRTHTGERPYTCDVCQKQ    351 - 420
FTQKSYLKCHKRSHTGEKPFECKDCKKVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLKLLRRHQKTH    421 - 490
PEATSQ                                                                    491 - 496
//

Text Mined References (7)

PMID Year Title