Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.27
PubTator Score 13.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non primary Sjogren syndrome sicca 840 0.0166025052983125
Disease Target Count Z-score Confidence
Leber congenital amaurosis 72 3.973 2.0
Retinitis pigmentosa 156 3.454 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 0.017

Synonym

Accession Q9BUF7 A8KA91 D6W643 Q8N0V8 Q8WVA0
Symbols

Gene

PDB

5I7Z  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Pig OMA EggNOG

Gene RIF (9)

PMID Text
26975581 Data show different intracellular mobility patterns for crumbs 3 proteins Crb3A and Crb3B.
26217016 CRB3A recruits p114RhoGEF and its activator Ehm2 to the cell periphery using both functional motifs of its cytoplasmic tail and increases RhoA activation levels.
25406012 our data demonstrated that CRB3 may be used as a new independent favorable prognostic factor for human ccRCC
23439680 Morg1 facilitates Par6-aPKC binding to Crb3 for definition of apical identity of epithelial cells.
17988153 overexpression of human CRB1 and related isoforms, CRB2 and CRB3, had no effect on the levels of presenilin complex components, on NCT maturation or on PS endoproteolysis
17646395 Data show that a novel Crumbs3 isoform regulates cell division and ciliogenesis via importin beta1 interactions.
15976445 The crumbs3 protein plays an important role in epithelial tight junction formation, and also provide the first known functional role for the mammalian Crumbs FERM binding domain.
14718572 CRB3, through its cytoplasmic domain and its interactors, plays a role in apical membrane morphogenesis and tight junction regulation.
12771187 the Crumbs3-Pals1 complex has a role in development of polarity in mammalian epithelial cells

AA Sequence

MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAAL      1 - 70
LLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI                         71 - 120
//

Text Mined References (20)

PMID Year Title
26975581 2016 The C-terminal domain controls the mobility of Crumbs 3 isoforms.
26217016 2015 CRB3A Controls the Morphology and Cohesion of Cancer Cells through Ehm2/p114RhoGEF-Dependent Signaling.
25416956 2014 A proteome-scale map of the human interactome network.
25406012 2015 Cell polarity protein CRB3 is an independent favorable prognostic factor for clear cell renal cell carcinoma.
23439680 2013 The WD40 protein Morg1 facilitates Par6-aPKC binding to Crb3 for apical identity in epithelial cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17988153 2007 Overexpression of human CRB1 or related isoforms, CRB2 and CRB3, does not regulate the human presenilin complex in culture cells.
17646395 2007 A novel Crumbs3 isoform regulates cell division and ciliogenesis via importin beta interactions.
17332497 2007 The MAGUK protein MPP7 binds to the polarity protein hDlg1 and facilitates epithelial tight junction formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...