Property Summary

NCBI Gene PubMed Count 20
PubMed Score 16.07
PubTator Score 13.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.7e-02

Gene RIF (10)

AA Sequence

MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAAL      1 - 70
LLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI                         71 - 120
//

Text Mined References (21)

PMID Year Title