Property Summary

Ligand Count 11
NCBI Gene PubMed Count 16
PubMed Score 8.01
PubTator Score 4.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0

Expression

  Differential Expression (34)

Disease log2 FC p
acute quadriplegic myopathy 1.247 1.1e-03
adrenocortical adenoma -1.036 4.6e-03
atypical teratoid / rhabdoid tumor 2.000 7.1e-05
autosomal dominant Emery-Dreifuss muscul... 1.505 5.4e-03
Becker muscular dystrophy 1.741 8.9e-04
Breast cancer -1.500 5.0e-05
breast carcinoma -1.200 8.5e-04
Chronic Lymphocytic Leukemia -1.446 2.2e-03
colon cancer -2.200 1.7e-02
Duchenne muscular dystrophy 2.585 6.8e-11
ependymoma 1.400 5.6e-06
esophageal adenocarcinoma -2.300 1.8e-02
fibroadenoma -1.300 2.0e-02
gastric carcinoma 1.800 1.7e-02
glioblastoma 1.300 3.0e-03
interstitial cystitis 1.400 2.4e-04
intraductal papillary-mucinous adenoma (... -3.800 1.6e-06
intraductal papillary-mucinous carcinoma... -3.700 9.7e-06
intraductal papillary-mucinous neoplasm ... -2.900 8.7e-04
invasive ductal carcinoma -1.700 2.8e-03
juvenile dermatomyositis 1.716 9.5e-09
limb girdle muscular dystrophy 2A 1.738 3.1e-07
lung adenocarcinoma -1.600 4.9e-06
lung cancer -2.600 1.8e-04
ovarian cancer -2.000 2.2e-04
pancreatic cancer 1.400 4.3e-03
pediatric high grade glioma 1.800 5.7e-05
pituitary cancer -2.200 5.2e-06
primary pancreatic ductal adenocarcinoma 1.586 3.0e-03
primitive neuroectodermal tumor 1.100 1.5e-02
psoriasis 2.100 1.0e-04
sonic hedgehog group medulloblastoma 1.400 5.6e-03
tuberculosis -1.200 2.2e-02
ulcerative colitis 2.600 2.3e-07

Gene RIF (10)

AA Sequence

MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLERINVYYNESSSQKYVPRAALVDLEP      1 - 70
GTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELVDAVLDVVRKECEHCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDARNMMAACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQSKNSSYFVEWIPNNVK    281 - 350
VAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATANDGEEAFEDEEEEIDG                                                421 - 446
//

Text Mined References (23)

PMID Year Title