Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.79
PubTator Score 4.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (68)

Disease Z-score Confidence
Lissencephaly 61 4.165 2.1
Microcephaly 149 3.955 2.0
Nail disease 8 3.379 1.7
Acute lymphoid leukemia 23
Anaplastic large T-cell systemic maligna... 10 
Becker muscular dystrophy 187
Breast cancer 3,094
Burkitt's lymphoma 15
Carcinoma of breast 11
Carcinoma of female breast 20
Chronic Lymphocytic Leukemia 242
Diffuse non-Hodgkin's lymphoma, large ce... 12 
Duchenne muscular dystrophy 602
Follicular non-Hodgkin's lymphoma 15
Gestational trophoblastic neoplasia 14
HER2-positive carcinoma of breast 10
Hodgkin's disease 16
Hypertensive disorder 57
Kaposi's sarcoma 20
Langerhans cell histiocytosis, dissemina... 10 
Liposarcoma 20
Malignant tumor of head and/or neck 15
Malignant tumor of ovary 25
Malignant tumor of prostate 11
Malignant tumor of stomach 12
Malignant tumor of testis 11
Metastatic Breast Carcinoma 21
Metastatic Prostate Carcinoma 18
Mycosis fungoides 26
Nephroblastoma 45
Neuroblastoma 78
Non-Hodgkin's lymphoma 20
Ocular hypertension 27
Open-angle glaucoma 26
Rhabdomyosarcoma 29
Secondary malignant neoplasm of pancreas 10
Transitional cell carcinoma 18
acute quadriplegic myopathy 1,157
adrenocortical adenoma 134
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
colon cancer 1,475
esophageal adenocarcinoma 737
fibroadenoma 557
gastric carcinoma 832
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2B 74
lung adenocarcinoma 2,713
lung cancer 4,466
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,683
sonic hedgehog group medulloblastoma 1,482
tuberculosis 1,557
ulcerative colitis 2,085

Expression

Synonym

Accession Q9BUF5 B3KM76 Q9HA42
Symbols TUBB-5
HsT1601

Gene

 GO Process (1)

Gene RIF (10)

PMID Text
24275654 Data indicate that leucine-rich repeat kinase 2 (LRRK2) selectively interacts with three beta-tubulin isoforms: TUBB, TUBB4, and TUBB6.
24173717 TUBB6 is an inhibitor of pyroptosis.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22903939 betaV-tubulin expression is a potentially promising prognostic marker of malignancy.
22438565 in colorectal cancer patients, there was a link between poor survival, the expression of TUBB3/TUBB6, and androgen receptor only in females
20191564 The TUBB6 expression was largely decreased in most tumors.
16526095 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15331610 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
12486001 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
10908577 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type

AA Sequence

MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLERINVYYNESSSQKYVPRAALVDLEP      1 - 70
GTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELVDAVLDVVRKECEHCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDARNMMAACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQSKNSSYFVEWIPNNVK    281 - 350
VAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATANDGEEAFEDEEEEIDG                                                421 - 446
//

Publication (23)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
24275654 2014 A direct interaction between leucine-rich repeat kinase 2 and specific ?-tubulin isoforms regulates tubulin acetylation.
24173717 2014 A cellular genome-wide association study reveals human variation in microtubule stability and a role in inflammatory cell death.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22903939 2012 Characterization of a human ?V-tubulin antibody and expression of this isotype in normal and malignant human tissue.
22438565 2012 Gender influences the class III and V ?-tubulin ability to predict poor outcome in colorectal cancer.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...