Property Summary

NCBI Gene PubMed Count 15
PubMed Score 39.05
PubTator Score 12.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.270 0.026
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.100 0.001
Breast cancer 3.600 0.022
ovarian cancer -2.500 0.000

Synonym

Accession Q9BUE6 B3KP34 B4DJI5 Q8ND75 Q9BZR2
Symbols ISA1
HBLD2
hIscA

Gene

Gene RIF (8)

PMID Text
24733926 The structural plasticity of the dimeric state of the [2Fe-2S] bound form of human GRX5 is the crucial factor that allows an efficient cluster transfer to the partner proteins human ISCA1 and ISCA2 by a specific protein-protein recognition mechanism.
24217246 The data presented here show that the Isu1 suppressor mimics the frataxin effects on Nfs1, explaining the bypassing activity.
22323289 ISCA1, ISCA2, and IBA57 were depleted by RNA interference. Depleted cells contained massively swollen and enlarged mitochondria that were virtually devoid of cristae membranes, demonstrating the importance of these proteins for mitochondrial biogenesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20302570 Iron-binding activity of human iron-sulfur cluster assembly protein hIscA1
19864422 human IscA1 plays an important role in both mitochondrial and cytosolic iron-sulfur cluster biogenesis, and a notable component of the latter is the interaction between IscA1 and IOP1.
19656490 Required for functional heme biosynthesis in erythroid cells.
15262227 screening a human brain cDNA expression library with serum from a patient suffering from the autoimmune Sjogren's syndrome yielded a gene product called hIscA implicated in iron-sulfur cluster biogenesis

AA Sequence

MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTK      1 - 70
GDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI                71 - 129
//

Publication (17)

PMID Year Title
26569474 2016 A magnetic protein biocompass.
24733926 2014 [2Fe-2S] cluster transfer in iron-sulfur protein biogenesis.
24217246 2013 Frataxin directly stimulates mitochondrial cysteine desulfurase by exposing substrate-binding sites, and a mutant Fe-S cluster scaffold protein with frataxin-bypassing ability acts similarly.
22323289 2012 The human mitochondrial ISCA1, ISCA2, and IBA57 proteins are required for [4Fe-4S] protein maturation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20302570 2010 Iron-binding activity of human iron-sulfur cluster assembly protein hIscA1.
19864422 2009 Human ISCA1 interacts with IOP1/NARFL and functions in both cytosolic and mitochondrial iron-sulfur protein biogenesis.
19656490 2009 Discovery of genes essential for heme biosynthesis through large-scale gene expression analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...