Property Summary

NCBI Gene PubMed Count 15
PubMed Score 45.67
PubTator Score 12.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 2.6e-05
Breast cancer 3.600 2.2e-02
medulloblastoma, large-cell -1.100 6.6e-04
Multiple myeloma 1.270 2.6e-02
ovarian cancer -2.500 4.0e-09

Gene RIF (8)

AA Sequence

MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTK      1 - 70
GDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI                71 - 129
//

Text Mined References (18)

PMID Year Title