Property Summary

NCBI Gene PubMed Count 21
Grant Count 23
R01 Count 14
Funding $3,450,847.09
PubMed Score 49.28
PubTator Score 20.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25945835 Data suggest that spondin-2 could be an independent diagnostic and prognostic biomarker of colon cancer.
25751394 Mindin protects against vascular hyperplasia by suppression of abnormal VSMC proliferation, migration and phenotypic switching in an AKT-dependent manner.
22615945 Using tissue microarray by immunohistostaining, we found SPON2 to be over-expressed in prostate cancer (PCa). SPON2 staining was more intense in Gleason score sum 7-8 and in PCa patients with metastasis.
21632881 mindin serves as a novel mediator that protects against cardiac hypertrophy and the transition to heart failure by blocking AKT/GSK3beta and TGF-beta1-Smad signalling.
21098016 High Mindin is associated with diabetic nephropathy in type 2 diabetes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19903741 Spondin 2, which is regulated by T(3), has an important role in cell invasion, cell migration, and hepatoma tumor progression.
19153605 The structure of the F-spondin domain of mindin was determined at 1.8-A resolution.

AA Sequence

MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWS      1 - 70
SLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAEL     71 - 140
EVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTV    141 - 210
TEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEV    211 - 280
SLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV                       281 - 331
//

Publication (22)

PMID Year Title
25945835 2015 Upregulation of spondin-2 predicts poor survival of colorectal carcinoma patients.
25751394 2015 Mindin regulates vascular smooth muscle cell phenotype and prevents neointima formation.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22615945 2012 Spondin-2 (SPON2), a more prostate-cancer-specific diagnostic biomarker.
21632881 2011 Cardiac-specific mindin overexpression attenuates cardiac hypertrophy via blocking AKT/GSK3? and TGF-?1-Smad signalling.
21098016 2011 Mindin: a novel marker for podocyte injury in diabetic nephropathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19903741 2010 Positive regulation of spondin 2 by thyroid hormone is associated with cell migration and invasion.
19153605 2009 Structure of the F-spondin domain of mindin, an integrin ligand and pattern recognition molecule.
More...