Property Summary

NCBI Gene PubMed Count 22
PubMed Score 56.24
PubTator Score 20.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.300 3.1e-02
adrenocortical carcinoma -1.943 7.4e-05
Breast cancer 1.500 6.6e-06
chronic kidney disease 1.500 1.8e-02
cystic fibrosis -1.600 6.9e-04
Endometriosis 1.098 2.9e-02
gastric carcinoma 2.100 1.1e-02
group 3 medulloblastoma 2.300 1.9e-03
Hydrolethalus syndrome -2.890 2.3e-02
interstitial cystitis 1.500 1.0e-03
interstitial lung disease 1.100 3.5e-02
intraductal papillary-mucinous adenoma (... -1.100 4.9e-03
intraductal papillary-mucinous carcinoma... -1.200 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.100 3.9e-02
ovarian cancer -1.500 5.2e-07
pancreatic cancer 2.700 5.6e-05
primary pancreatic ductal adenocarcinoma 2.259 3.0e-04
psoriasis -1.100 1.1e-06
type I diabetes mellitus -1.242 1.4e-02
ulcerative colitis 1.700 2.7e-04

Gene RIF (9)

AA Sequence

MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWS      1 - 70
SLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAEL     71 - 140
EVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTV    141 - 210
TEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEV    211 - 280
SLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV                       281 - 331
//

Text Mined References (23)

PMID Year Title