Property Summary

NCBI Gene PubMed Count 21
PubMed Score 49.28
PubTator Score 20.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 1.13165818557744E-6
pancreatic cancer 2300 5.5986470111206E-5
adrenocortical carcinoma 1427 7.40749047774043E-5
ulcerative colitis 2087 2.71352966313389E-4
primary pancreatic ductal adenocarcinoma 1271 3.0080768204816E-4
cystic fibrosis 1670 6.91958468702742E-4
ovarian cancer 8492 8.37560238297131E-4
interstitial cystitis 2299 0.00104260489122958
Breast cancer 3099 0.00161299829777813
group 3 medulloblastoma 2254 0.00194519611427992
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00489752369084977
gastric carcinoma 832 0.0113477703280376
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0121383805322369
type I diabetes mellitus 22 0.0136530534078549
chronic kidney disease 90 0.0181364204496996
Hydrolethalus syndrome 128 0.0231673274423181
Endometriosis 535 0.0294061819911624
acute myeloid leukemia 785 0.0308231747625862
interstitial lung disease 292 0.0345775341058752
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0388594133420456
Disease Target Count Z-score Confidence
Hypermobility syndrome 17 3.429 1.7

Expression

Synonym

Accession Q9BUD6 D3DVN9 Q4W5N4 Q9ULW1
Symbols DIL1
DIL-1
MINDIN
M-SPONDIN

Gene

PDB

3D34  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
25945835 Data suggest that spondin-2 could be an independent diagnostic and prognostic biomarker of colon cancer.
25751394 Mindin protects against vascular hyperplasia by suppression of abnormal VSMC proliferation, migration and phenotypic switching in an AKT-dependent manner.
22615945 Using tissue microarray by immunohistostaining, we found SPON2 to be over-expressed in prostate cancer (PCa). SPON2 staining was more intense in Gleason score sum 7-8 and in PCa patients with metastasis.
21632881 mindin serves as a novel mediator that protects against cardiac hypertrophy and the transition to heart failure by blocking AKT/GSK3beta and TGF-beta1-Smad signalling.
21098016 High Mindin is associated with diabetic nephropathy in type 2 diabetes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19903741 Spondin 2, which is regulated by T(3), has an important role in cell invasion, cell migration, and hepatoma tumor progression.
19153605 The structure of the F-spondin domain of mindin was determined at 1.8-A resolution.

AA Sequence

MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWS      1 - 70
SLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAEL     71 - 140
EVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTV    141 - 210
TEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEV    211 - 280
SLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV                       281 - 331
//

Text Mined References (22)

PMID Year Title
25945835 2015 Upregulation of spondin-2 predicts poor survival of colorectal carcinoma patients.
25751394 2015 Mindin regulates vascular smooth muscle cell phenotype and prevents neointima formation.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22615945 2012 Spondin-2 (SPON2), a more prostate-cancer-specific diagnostic biomarker.
21632881 2011 Cardiac-specific mindin overexpression attenuates cardiac hypertrophy via blocking AKT/GSK3? and TGF-?1-Smad signalling.
21098016 2011 Mindin: a novel marker for podocyte injury in diabetic nephropathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19903741 2010 Positive regulation of spondin 2 by thyroid hormone is associated with cell migration and invasion.
19153605 2009 Structure of the F-spondin domain of mindin, an integrin ligand and pattern recognition molecule.
More...