Tchem | MAP kinase-interacting serine/threonine-protein kinase 1 |
This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2012]
Comments
Disease | Target Count |
---|---|
Substance-Related Disorders | 114 |
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 3.11344274989141E-11 |
ependymoma | 2514 | 4.76014455596763E-7 |
ovarian cancer | 8492 | 9.38615527233923E-7 |
atypical teratoid / rhabdoid tumor | 4369 | 3.73697050299951E-6 |
medulloblastoma, large-cell | 6234 | 1.00107816475047E-5 |
pediatric high grade glioma | 2712 | 1.55366244038941E-5 |
glioblastoma | 5572 | 7.00818317584727E-5 |
primitive neuroectodermal tumor | 3031 | 1.87993453218998E-4 |
osteosarcoma | 7933 | 4.52574977937363E-4 |
Pick disease | 1893 | 7.9508816829748E-4 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 9.81740197355477E-4 |
astrocytoma | 1493 | 0.00186977840620554 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 0.00188400457140255 |
primary pancreatic ductal adenocarcinoma | 1271 | 0.00291675581771352 |
medulloblastoma | 1524 | 0.00353207706704986 |
pancreatic cancer | 2300 | 0.00834249601793706 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00917800084278621 |
subependymal giant cell astrocytoma | 2287 | 0.0184664339317859 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -1.415 | 0.000 |
ependymoma | -1.400 | 0.000 |
glioblastoma | -2.100 | 0.000 |
medulloblastoma | -1.500 | 0.004 |
astrocytoma | 1.300 | 0.002 |
atypical teratoid / rhabdoid tumor | -2.100 | 0.000 |
medulloblastoma, large-cell | -2.800 | 0.000 |
primitive neuroectodermal tumor | -1.900 | 0.000 |
primary pancreatic ductal adenocarcinoma | -1.416 | 0.003 |
non-small cell lung cancer | -1.055 | 0.000 |
intraductal papillary-mucinous adenoma (... | -1.700 | 0.001 |
intraductal papillary-mucinous carcinoma... | -1.700 | 0.002 |
intraductal papillary-mucinous neoplasm ... | -1.800 | 0.009 |
pediatric high grade glioma | -1.700 | 0.000 |
subependymal giant cell astrocytoma | 1.733 | 0.018 |
Pick disease | 1.100 | 0.001 |
ovarian cancer | -1.900 | 0.000 |
pancreatic cancer | -1.400 | 0.008 |
Species | Source |
---|---|
Macaque | OMA Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA Inparanoid |
Cow | OMA Inparanoid |
Opossum | OMA Inparanoid |
Chicken | OMA Inparanoid |
Xenopus | OMA Inparanoid |
CHEMBL1271532
pIC50 7.57
CHEMBL574738
pKd 7.59
CHEMBL478629
pIC50 7.96
CHEMBL3354999
pIC50 8.22
CHEMBL3354997
pIC50 8.22
CHEMBL3354998
pIC50 8.30
CHEMBL3797828
pIC50 8.40
CHEMBL3800585
pIC50 8.52
CHEMBL3798762
pIC50 8.70
CHEMBL3797873
pIC50 8.82
CHEMBL3355002
pIC50 9.00
CHEMBL3355000
pIC50 9.00
PMID | Text |
---|---|
26668315 | Data suggest MNK1/MNK2 stimulate mRNA translation but only of mRNA containing both 5-prime-terminal cap and hairpin duplex; this stimulation involves up-regulation of phosphorylation/mRNA un-winding activity of eIF4E (via decreased binding to eIF4G). |
26147685 | Data show that interferon-gamma regulated the metabolism and mRNA translation of macrophages by targeting the kinases mTORC1 and MNK1/2, both of which converge on the selective regulator of translation initiation eukaryotic initiation factor-4E (eIF4E). |
25605250 | Simultaneous targeting of androgen receptor and MNK1 by novel retinamides inhibits growth of human prostate cancer cell lines. |
25527453 | Data suggest that a combined pharmacologic inhibition of mTORC1 and Mnk1/2 kinases offers a therapeutic opportunity in blast crisis-chronic myeloid leukemia (BC-CML). |
25403230 | MNK1 and MNK2 inhibition ablates eIF4E1 phosphorylation and concurrently enhances eIF4E3 expression in diffuse large B-cell lymphoma. |
25187541 | ERK1/2 signal induced MNK catalytic activity enabled enterovirus type 1 internal ribosomal entry site-mediated translation/host cell cytotoxicity through negative regulation of the Ser/Arg (SR)-rich protein kinase (SRPK). |
25187540 | Authors show that MNK regulates SRPK via mTOR and AKT. |
24714040 | These data indicate multiple myeloma cells exploit the MNK/eIF-4E pathway for selective mRNA translation without enhancing global translation and risking ER stress. |
24551240 | High expression of p-Mnk1 and p-eIF4E might be novel valuable biomarkers to predict poor prognosis of nasopharyngeal carcinoma. |
24401275 | rapalog-activated MNK1 signaling promotes glioma growth through regulation of 4EBP1; there is a molecular cross-talk between the mTORC1 and MNK1 pathways |
More... |
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQ 1 - 70 NGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQK 71 - 140 HFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR 141 - 210 DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDK 211 - 280 RCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDL 281 - 350 ISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL 351 - 420 AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL 421 - 465 //
PMID | Year | Title |
---|---|---|
26668315 | 2016 | Inhibition of Mitogen-activated Protein Kinase (MAPK)-interacting Kinase (MNK) Preferentially Affects Translation of mRNAs Containing Both a 5'-Terminal Cap and Hairpin. |
26147685 | 2015 | Interferon-? regulates cellular metabolism and mRNA translation to potentiate macrophage activation. |
25605250 | 2015 | Simultaneous targeting of androgen receptor (AR) and MAPK-interacting kinases (MNKs) by novel retinamides inhibits growth of human prostate cancer cell lines. |
25527453 | 2015 | Pharmacologic co-inhibition of Mnks and mTORC1 synergistically suppresses proliferation and perturbs cell cycle progression in blast crisis-chronic myeloid leukemia cells. |
25403230 | 2014 | MNKs act as a regulatory switch for eIF4E1 and eIF4E3 driven mRNA translation in DLBCL. |
25187541 | 2014 | Induction of viral, 7-methyl-guanosine cap-independent translation and oncolysis by mitogen-activated protein kinase-interacting kinase-mediated effects on the serine/arginine-rich protein kinase. |
25187540 | 2014 | Mitogen-activated protein kinase-interacting kinase regulates mTOR/AKT signaling and controls the serine/arginine-rich protein kinase-responsive type 1 internal ribosome entry site-mediated translation and viral oncolysis. |
24714040 | 2014 | MNK1-induced eIF-4E phosphorylation in myeloma cells: a pathway mediating IL-6-induced expansion and expression of genes involved in metabolic and proteotoxic responses. |
24551240 | 2014 | Phosphorylated Mnk1 and eIF4E are associated with lymph node metastasis and poor prognosis of nasopharyngeal carcinoma. |
24401275 | 2014 | MNK1 pathway activity maintains protein synthesis in rapalog-treated gliomas. |
More... |