Property Summary

Ligand Count 12
NCBI Gene PubMed Count 62
PubMed Score 46.73
PubTator Score 52.24

Knowledge Summary

Patent (12,675)

Expression

  Differential Expression (18)

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (40)

AA Sequence

MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQ      1 - 70
NGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQK     71 - 140
HFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR    141 - 210
DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDK    211 - 280
RCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDL    281 - 350
ISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL    351 - 420
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL                             421 - 465
//

Text Mined References (65)

PMID Year Title