Property Summary

NCBI Gene PubMed Count 57
Grant Count 17
R01 Count 14
Funding $932,810.72
PubMed Score 42.07
PubTator Score 52.24

Knowledge Summary

Patent (12,675)

Expression

 MGI Term (1)

 GWAS Trait (1)

Gene RIF (35)

PMID Text
26668315 Data suggest MNK1/MNK2 stimulate mRNA translation but only of mRNA containing both 5-prime-terminal cap and hairpin duplex; this stimulation involves up-regulation of phosphorylation/mRNA un-winding activity of eIF4E (via decreased binding to eIF4G).
26147685 Data show that interferon-gamma regulated the metabolism and mRNA translation of macrophages by targeting the kinases mTORC1 and MNK1/2, both of which converge on the selective regulator of translation initiation eukaryotic initiation factor-4E (eIF4E).
25605250 Simultaneous targeting of androgen receptor and MNK1 by novel retinamides inhibits growth of human prostate cancer cell lines.
25527453 Data suggest that a combined pharmacologic inhibition of mTORC1 and Mnk1/2 kinases offers a therapeutic opportunity in blast crisis-chronic myeloid leukemia (BC-CML).
25403230 MNK1 and MNK2 inhibition ablates eIF4E1 phosphorylation and concurrently enhances eIF4E3 expression in diffuse large B-cell lymphoma.
25187541 ERK1/2 signal induced MNK catalytic activity enabled enterovirus type 1 internal ribosomal entry site-mediated translation/host cell cytotoxicity through negative regulation of the Ser/Arg (SR)-rich protein kinase (SRPK).
25187540 Authors show that MNK regulates SRPK via mTOR and AKT.
24714040 These data indicate multiple myeloma cells exploit the MNK/eIF-4E pathway for selective mRNA translation without enhancing global translation and risking ER stress.
24551240 High expression of p-Mnk1 and p-eIF4E might be novel valuable biomarkers to predict poor prognosis of nasopharyngeal carcinoma.
24401275 rapalog-activated MNK1 signaling promotes glioma growth through regulation of 4EBP1; there is a molecular cross-talk between the mTORC1 and MNK1 pathways
More...

AA Sequence

MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQ      1 - 70
NGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQK     71 - 140
HFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR    141 - 210
DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDK    211 - 280
RCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDL    281 - 350
ISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL    351 - 420
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL                             421 - 465
//

Publication (60)

PMID Year Title
26668315 2016 Inhibition of Mitogen-activated Protein Kinase (MAPK)-interacting Kinase (MNK) Preferentially Affects Translation of mRNAs Containing Both a 5'-Terminal Cap and Hairpin.
26147685 2015 Interferon-? regulates cellular metabolism and mRNA translation to potentiate macrophage activation.
25605250 2015 Simultaneous targeting of androgen receptor (AR) and MAPK-interacting kinases (MNKs) by novel retinamides inhibits growth of human prostate cancer cell lines.
25527453 2015 Pharmacologic co-inhibition of Mnks and mTORC1 synergistically suppresses proliferation and perturbs cell cycle progression in blast crisis-chronic myeloid leukemia cells.
25403230 2014 MNKs act as a regulatory switch for eIF4E1 and eIF4E3 driven mRNA translation in DLBCL.
25187541 2014 Induction of viral, 7-methyl-guanosine cap-independent translation and oncolysis by mitogen-activated protein kinase-interacting kinase-mediated effects on the serine/arginine-rich protein kinase.
25187540 2014 Mitogen-activated protein kinase-interacting kinase regulates mTOR/AKT signaling and controls the serine/arginine-rich protein kinase-responsive type 1 internal ribosome entry site-mediated translation and viral oncolysis.
24714040 2014 MNK1-induced eIF-4E phosphorylation in myeloma cells: a pathway mediating IL-6-induced expansion and expression of genes involved in metabolic and proteotoxic responses.
24551240 2014 Phosphorylated Mnk1 and eIF4E are associated with lymph node metastasis and poor prognosis of nasopharyngeal carcinoma.
24401275 2014 MNK1 pathway activity maintains protein synthesis in rapalog-treated gliomas.
More...