Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.44
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 6.92391580409745E-10
osteosarcoma 7933 3.13572811324837E-7
non primary Sjogren syndrome sicca 840 0.0211315295597728

Synonym

Accession Q9BUA6
Symbols PLRLC
MYLC2PL

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain

AA Sequence

MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGM      1 - 70
ISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFT     71 - 140
VFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNL    141 - 210
DYRNLCYVITHGEEKD                                                          211 - 226
//

Text Mined References (9)

PMID Year Title
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
1628631 1992 A novel regulatory myosin light chain gene distinguishes pre-B cell subsets and is IL-7 inducible.