Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.44
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain

AA Sequence

MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGM      1 - 70
ISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFT     71 - 140
VFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNL    141 - 210
DYRNLCYVITHGEEKD                                                          211 - 226
//

Publication (9)

PMID Year Title
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
1628631 1992 A novel regulatory myosin light chain gene distinguishes pre-B cell subsets and is IL-7 inducible.