Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.64
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis -1.124 6.9e-10
non primary Sjogren syndrome sicca 1.100 2.1e-02
osteosarcoma 1.938 3.1e-07

Synonym

Accession Q9BUA6
Symbols PLRLC
MYLC2PL

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGM      1 - 70
ISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFT     71 - 140
VFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNL    141 - 210
DYRNLCYVITHGEEKD                                                          211 - 226
//

Text Mined References (9)

PMID Year Title