Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.9

Expression

AA Sequence

MALKAEGAALDCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQ      1 - 70
VSWEQEFLVGSSPGGSGRALCMVCGAEIRAPSADTARSHILEQHPHTLDLSPSEKSNILEAWSEGVALLQ     71 - 140
DVRAEQPSPPNSDSGQDAHPDPDANPDAARMPAEIVVLLDSEDNPSLPKRSRPRGLRPLELPAVPATEPG    141 - 210
NKKPRGQRWKEPPGEEPVRKKRGRPMTKNLDPDPEPPSPDSPTETFAAPAEVRHFTDGSFPAGFVLQLFS    211 - 280
HTQLRGPDSKDSPKDREVAEGGLPRAESPSPAPPPGLRGTLDLQVIRVRMEEPPAVSLLQDWSRHPQGTK    281 - 350
RVGAGDTSDWPTVLSESSTTVAGKPEKGNGV                                           351 - 381
//

Text Mined References (19)

PMID Year Title