Property Summary

NCBI Gene PubMed Count 13
PubMed Score 21.04
PubTator Score 13.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Malaria 160 3.464 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.200 1.6e-03
atypical teratoid / rhabdoid tumor -1.100 3.2e-04
glioblastoma -1.100 2.1e-04
non primary Sjogren syndrome sicca 1.300 2.1e-02
osteosarcoma -1.672 1.1e-06

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA      1 - 70
IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA     71 - 140
AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG    141 - 210
YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY    211 - 280
EHETGRAFQYADGLEQLRGAPS                                                    281 - 302
//

Text Mined References (16)

PMID Year Title