Property Summary

NCBI Gene PubMed Count 13
Grant Count 19
R01 Count 1
Funding $1,716,190.9
PubMed Score 6.76
PubTator Score 13.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.672 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.000
adult high grade glioma -1.200 0.002
non primary Sjogren syndrome sicca 1.300 0.021

Gene RIF (8)

PMID Text
25865244 Data describes 3-D structure of hDOHH in two states, hDOHHperoxo (POX) and a complex of the diiron core with glycerol (GLC) providing an explanation for the extreme longevity of POX and illustrate its substrate specificity for deoxyhypusine-eIF-5A.
24843120 Here, we show that PCBP1 and PCBP2 also deliver iron to deoxyhypusine hydroxylase (DOHH), the dinuclear iron enzyme required for hypusine modification of the translation factor eukaryotic initiation factor 5A.
22927971 eIF-5A as well as the hypusine-forming enzymes deoxyhypusine synthase (DHS) and deoxyhypusine hydroxylase (DOHH) are highly overexpressed in glioblastoma patient sample
22908221 a novel role for miR-331-3p and miR-642-5p in the control of prostate cancer cell growth via the regulation of DOHH expression and eIF5A activity.
22190034 HIV-1 PR is identified to have a physical interaction with deoxyhypusine hydroxylase/monooxygenase (DOHH) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19706422 Resonance Raman experiments show that its blue chromophore arises from a (mu-1,2-peroxo)diiron(III) center that forms in the reaction of the reduced enzyme with O2, so the peroxo form of hDOHH is unusually stable.
17213197 analysis of the deoxyhypusine hydroxylase-eukaryotic translation initiation factor (eIF5A) interaction
16533814 The structure and function of DOHH are reported.

AA Sequence

MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA      1 - 70
IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA     71 - 140
AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG    141 - 210
YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY    211 - 280
EHETGRAFQYADGLEQLRGAPS                                                    281 - 302
//

Publication (16)

PMID Year Title
25865244 2015 Crystal Structure of the Peroxo-diiron(III) Intermediate of Deoxyhypusine Hydroxylase, an Oxygenase Involved in Hypusination.
24843120 2014 Iron chaperones PCBP1 and PCBP2 mediate the metallation of the dinuclear iron enzyme deoxyhypusine hydroxylase.
22927971 2012 Expression of eukaryotic initiation factor 5A and hypusine forming enzymes in glioblastoma patient samples: implications for new targeted therapies.
22908221 2012 Regulation of expression of deoxyhypusine hydroxylase (DOHH), the enzyme that catalyzes the activation of eIF5A, by miR-331-3p and miR-642-5p in prostate cancer cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19706422 2009 Human deoxyhypusine hydroxylase, an enzyme involved in regulating cell growth, activates O2 with a nonheme diiron center.
17476569 2007 Posttranslational synthesis of hypusine: evolutionary progression and specificity of the hypusine modification.
17213197 2007 Specificity of the deoxyhypusine hydroxylase-eukaryotic translation initiation factor (eIF5A) interaction: identification of amino acid residues of the enzyme required for binding of its substrate, deoxyhypusine-containing eIF5A.
More...