Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.25
PubTator Score 1.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.550 0.000
glioblastoma 1.200 0.005
atypical teratoid / rhabdoid tumor -1.200 0.003
non-small cell lung cancer -1.639 0.000
lung cancer -2.600 0.000
group 4 medulloblastoma -1.200 0.010
lung carcinoma -2.800 0.000
ovarian cancer -1.400 0.002

Gene RIF (2)

PMID Text
20351715 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
15556294 Data showed MGC4175 fused to the carboxy terminus of enhanced green fluorescent protein (EGFP) was localized to the mitochondria, and its overexpression was not caused by genomic amplification or gene arrangement.

AA Sequence

MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPLNIFFAVCISL      1 - 70
SSITACILIYWYRQGDLEPKFRKLIYYIIFSIIMLCICANLYFHDVGR                           71 - 118
//

Publication (11)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20351715 2011 Meta-analysis of genome-wide association data of bipolar disorder and major depressive disorder.
18510171 2008 Multiple pathways are involved in drug resistance to doxorubicin in an osteosarcoma cell line.
16382445 2006 Regional activation of chromosomal arm 7q with and without gene amplification in taxane-selected human ovarian cancer cell lines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15556294 2004 MM-TRAG (MGC4175), a novel intracellular mitochondrial protein, is associated with the taxol- and doxorubicin-resistant phenotype in human cancer cell lines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...