Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 4104 5.8e-03

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 5.8e-03

AA Sequence

MFGSSRGGVRGGQDQFNWEDVKTDKQRENYLGNSLMAPVGRWQKGRDLTWYAKGRAPCAGPSREEELAAV      1 - 70
REAEREALLAALGYKNVKKQPTGLSKEDFAEVCKREGGDPEEKGVDRLLGLGSASGSVGRVAMSREDKEA     71 - 140
AKLGLSVFTHHRVESGGPGTSAASARRKPRAEDQTESSCESHRKSKKEKKKKKKRKHKKEKKKKDKEHRR    141 - 210
PAEATSSPTSPERPRHHHHDSDSNSPCCKRRKRGHSGDRRSPSRRWHDRGSEA                     211 - 263
//

Text Mined References (24)

PMID Year Title