Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.68
PubTator Score 1.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 2.8e-05
lung cancer 4740 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Isolated cleft palate 4 4.605 2.3

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.300 1.1e-03
tuberculosis -1.100 2.8e-05

Synonym

Accession Q9BU70 Q5T113 Q86SK0 Q9NXJ7 Q9P0Q7
Symbols NAP1
HSPC219
C9orf156

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MRGLEESGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNP      1 - 70
EHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAI     71 - 140
YLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQ    141 - 210
PHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSF    211 - 280
SEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLG    281 - 350
QLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRI    351 - 420
KPASEPVHMTGPVGSLVSLGS                                                     421 - 441
//

Text Mined References (11)

PMID Year Title