Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.54
PubTator Score 1.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466
tuberculosis 1,557

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis -1.100 0.000
lung cancer -1.300 0.001

Gene RIF (2)

PMID Text
20583170 Observational study of gene-disease association. (HuGE Navigator)
19779022 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRGLEESGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNP      1 - 70
EHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAI     71 - 140
YLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQ    141 - 210
PHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSF    211 - 280
SEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLG    281 - 350
QLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRI    351 - 420
KPASEPVHMTGPVGSLVSLGS                                                     421 - 441
//

Text Mined References (11)

PMID Year Title
25063302 2014 Discovery of the ?-barrel-type RNA methyltransferase responsible for N6-methylation of N6-threonylcarbamoyladenosine in tRNAs.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20350937 2010 The FOXE1 locus is a major genetic determinant for radiation-related thyroid carcinoma in Chernobyl.
19779022 2009 FOXE1 association with both isolated cleft lip with or without cleft palate, and isolated cleft palate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
More...