Property Summary

NCBI Gene PubMed Count 25
PubMed Score 4.97
PubTator Score 5.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 6.70975413148087E-16
osteosarcoma 7933 3.35790346565638E-11
psoriasis 6685 7.456428406643E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00124486870022292
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00171922841692528
group 3 medulloblastoma 2254 0.00624157236302519
colon cancer 1475 0.00633693647848064
Breast cancer 3099 0.0345265158958299
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -3.100 0.000
osteosarcoma -2.802 0.000
non-small cell lung cancer 1.281 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.001
intraductal papillary-mucinous neoplasm ... 1.300 0.002
colon cancer 1.500 0.006
Breast cancer 2.200 0.035
group 3 medulloblastoma 1.100 0.006

Synonym

Accession Q9BU64 B2RDC0 D6W536 Q53T55 Q96JV3 CENP-O
Symbols CENP-O
MCM21R
ICEN-36

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (3)

PMID Text
23028590 Data propose that CENP-P/O/R/Q/U self-assembles on kinetochores with varying stoichiometry and undergoes a pre-mitotic maturation step that could be important for kinetochores switching into the correct conformation for microtubule-attachment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19286853 CENP-O protein is a novel centromere antigen that is recognized by a very minor population of ACA-positive patients with scleroderma.

AA Sequence

MEQANPLRPDGESKGGVLAHLERLETQVSRSRKQSEELQSVQAQEGALGTKIHKLRRLRDELRAVVRHRR      1 - 70
ASVKACIANVEPNQTVEINEQEALEEKLENVKAILQAYHFTGLSGKLTSRGVCVCISTAFEGNLLDSYFV     71 - 140
DLVIQKPLRIHHHSVPVFIPLEEIAAKYLQTNIQHFLFSLCEYLNAYSGRKYQADRLQSDFAALLTGPLQ    141 - 210
RNPLCNLLSFTYKLDPGGQSFPFCARLLYKDLTATLPTDVTVTCQGVEVLSTSWEEQRASHETLFCTKPL    211 - 280
HQVFASFTRKGEKLDMSLVS                                                      281 - 300
//

Text Mined References (26)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028590 2012 Step-wise assembly, maturation and dynamic behavior of the human CENP-P/O/R/Q/U kinetochore sub-complex.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19286853 2009 CENP-O, a protein localized at the centromere throughout the cell cycle, is a novel target antigen in systemic sclerosis.
19204145 2009 Kinetochore-generated pushing forces separate centrosomes during bipolar spindle assembly.
More...