Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.22
PubTator Score 5.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 2.200 3.5e-02
colon cancer 1.500 6.3e-03
group 3 medulloblastoma 1.100 6.2e-03
intraductal papillary-mucinous carcinoma... 1.100 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.7e-03
non-small cell lung cancer 1.281 6.7e-16
osteosarcoma -2.802 3.4e-11
psoriasis -3.100 7.5e-05

Protein-protein Interaction (5)

Gene RIF (3)

AA Sequence

MEQANPLRPDGESKGGVLAHLERLETQVSRSRKQSEELQSVQAQEGALGTKIHKLRRLRDELRAVVRHRR      1 - 70
ASVKACIANVEPNQTVEINEQEALEEKLENVKAILQAYHFTGLSGKLTSRGVCVCISTAFEGNLLDSYFV     71 - 140
DLVIQKPLRIHHHSVPVFIPLEEIAAKYLQTNIQHFLFSLCEYLNAYSGRKYQADRLQSDFAALLTGPLQ    141 - 210
RNPLCNLLSFTYKLDPGGQSFPFCARLLYKDLTATLPTDVTVTCQGVEVLSTSWEEQRASHETLFCTKPL    211 - 280
HQVFASFTRKGEKLDMSLVS                                                      281 - 300
//

Text Mined References (26)

PMID Year Title