Property Summary

NCBI Gene PubMed Count 25
PubMed Score 4.97
PubTator Score 5.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -3.100 0.000
osteosarcoma -2.802 0.000
non-small cell lung cancer 1.281 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.001
intraductal papillary-mucinous neoplasm ... 1.300 0.002
colon cancer 1.500 0.006
Breast cancer 2.200 0.035
group 3 medulloblastoma 1.100 0.006

Synonym

Accession Q9BU64 B2RDC0 D6W536 Q53T55 Q96JV3 CENP-O
Symbols CENP-O
MCM21R
ICEN-36

Gene

 GWAS Trait (1)

Gene RIF (3)

PMID Text
23028590 Data propose that CENP-P/O/R/Q/U self-assembles on kinetochores with varying stoichiometry and undergoes a pre-mitotic maturation step that could be important for kinetochores switching into the correct conformation for microtubule-attachment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19286853 CENP-O protein is a novel centromere antigen that is recognized by a very minor population of ACA-positive patients with scleroderma.

AA Sequence

MEQANPLRPDGESKGGVLAHLERLETQVSRSRKQSEELQSVQAQEGALGTKIHKLRRLRDELRAVVRHRR      1 - 70
ASVKACIANVEPNQTVEINEQEALEEKLENVKAILQAYHFTGLSGKLTSRGVCVCISTAFEGNLLDSYFV     71 - 140
DLVIQKPLRIHHHSVPVFIPLEEIAAKYLQTNIQHFLFSLCEYLNAYSGRKYQADRLQSDFAALLTGPLQ    141 - 210
RNPLCNLLSFTYKLDPGGQSFPFCARLLYKDLTATLPTDVTVTCQGVEVLSTSWEEQRASHETLFCTKPL    211 - 280
HQVFASFTRKGEKLDMSLVS                                                      281 - 300
//

Publication (26)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028590 2012 Step-wise assembly, maturation and dynamic behavior of the human CENP-P/O/R/Q/U kinetochore sub-complex.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19286853 2009 CENP-O, a protein localized at the centromere throughout the cell cycle, is a novel target antigen in systemic sclerosis.
19204145 2009 Kinetochore-generated pushing forces separate centrosomes during bipolar spindle assembly.
More...