Property Summary

NCBI Gene PubMed Count 24
PubMed Score 97.91
PubTator Score 89.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Congenital keratoglobus 14
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.7
Disease Target Count Z-score Confidence
Corneal degeneration 3 4.031 2.0
Scurvy 10 3.17 1.6

Expression

  Differential Expression (36)

Disease log2 FC p
acute myeloid leukemia -2.400 4.7e-02
adrenocortical carcinoma -1.498 2.2e-07
aldosterone-producing adenoma -1.192 1.9e-02
astrocytic glioma -1.600 2.3e-02
Atopic dermatitis -2.800 1.7e-04
atypical teratoid / rhabdoid tumor -2.400 8.0e-05
autosomal dominant Emery-Dreifuss muscul... 1.605 1.0e-02
Breast cancer -4.000 2.9e-02
breast carcinoma -1.200 2.2e-04
colon cancer -3.600 9.9e-04
cystic fibrosis 3.379 1.2e-07
dermatomyositis 1.200 1.6e-02
diabetes mellitus -1.100 1.8e-02
Duchenne muscular dystrophy 1.989 1.7e-08
ductal carcinoma in situ -2.800 1.0e-04
ependymoma -1.800 4.5e-02
fibroadenoma -1.600 6.6e-03
glioblastoma -1.400 1.3e-02
group 3 medulloblastoma -3.000 5.6e-03
intraductal papillary-mucinous adenoma (... -3.400 2.9e-03
intraductal papillary-mucinous carcinoma... -4.900 1.0e-04
intraductal papillary-mucinous neoplasm ... -4.600 2.7e-03
invasive ductal carcinoma -3.460 1.0e-04
juvenile dermatomyositis 1.246 3.2e-08
limb girdle muscular dystrophy 2A 1.109 2.6e-03
lung adenocarcinoma -1.900 9.1e-09
lung cancer -5.400 4.2e-07
lung carcinoma -3.600 8.4e-24
medulloblastoma, large-cell -3.200 2.4e-05
non-small cell lung cancer -3.990 6.6e-26
osteosarcoma -3.056 3.1e-02
ovarian cancer -5.700 1.3e-13
pancreatic cancer -1.100 4.0e-02
Pick disease -1.200 7.3e-03
pituitary cancer -2.300 1.5e-06
psoriasis -1.600 1.5e-04

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

MGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLVYCVNCICSENGNVLCS      1 - 70
RVRCPNVHCLSPVHIPHLCCPRCPDSLPPVNNKVTSKSCEYNGTTYQHGELFVAEGLFQNRQPNQCTQCS     71 - 140
CSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRGDGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPS    141 - 210
RQAGGLSRFPGARSHRGALMDSQQASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECV    211 - 280
LCTCNVTKQECKKIHCPNRYPCKYPQKIDGKCCKVCPGKKAKELPGQSFDNKGYFCGEETMPVYESVFME    281 - 350
DGETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEGEAQI    351 - 420
SQMCSSRVCRTELEDLVKVLYLERSEKGHC                                            421 - 450
//

Text Mined References (24)

PMID Year Title