Property Summary

NCBI Gene PubMed Count 8
PubMed Score 12.17
PubTator Score 3.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Globe disease 67 0.0 3.0
Disease Target Count Z-score Confidence
Keratitis 62 3.137 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma 1.200 4.2e-03
invasive ductal carcinoma 1.200 2.9e-03
lung adenocarcinoma 1.700 2.1e-07
lung cancer 1.300 9.3e-03
osteosarcoma -1.591 1.7e-05
pancreatic ductal adenocarcinoma liver m... 1.277 6.5e-03
Pick disease -1.300 1.2e-05
tuberculosis 1.200 4.3e-04

Gene RIF (2)

AA Sequence

MASSPAVDVSCRRREKRRQLDARRSKCRIRLGGHMEQWCLLKERLGFSLHSQLAKFLLDRYTSSGCVLCA      1 - 70
GPEPLPPKGLQYLVLLSHAHSRECSLVPGLRGPGGQDGGLVWECSAGHTFSWGPSLSPTPSEAPKPASLP     71 - 140
HTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFPPPGEEEGEEEEDNDEDEEEMLSDAS    141 - 210
LWTYSSSPDDSEPDAPRLLPSPVTCTPKEGETPPAPAALSSPLAVPALSASSLSSRAPPPAEVRVQPQLS    211 - 280
RTPQAAQQTEALASTGSQAQSAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKK    281 - 350
YQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFCARSFRTSSNLVIHRRIHTGEKPLQCE    351 - 420
ICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESPSGPLEPCP    421 - 490
SISAPGPLGSSEGSRPSASPQAPTLLPQQ                                             491 - 519
//

Text Mined References (10)

PMID Year Title