Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.06
PubTator Score 3.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 2.12759834814995E-7
Pick disease 1893 1.20326035365496E-5
osteosarcoma 7933 2.42441551032975E-5
tuberculosis 1563 4.29248271952004E-4
lung cancer 4473 9.71257330975236E-4
invasive ductal carcinoma 2950 0.00286681463719579
group 3 medulloblastoma 2254 0.00419059399106686
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00651006031401356
Disease Target Count Z-score Confidence
Globe disease 57 0.0 2.0
Disease Target Count Z-score Confidence
Keratitis 42 3.341 1.7
Hyperopia 33 3.079 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.613 0.000
tuberculosis 1.200 0.000
pancreatic ductal adenocarcinoma liver m... 1.277 0.007
lung cancer 1.400 0.001
group 3 medulloblastoma 1.200 0.004
lung adenocarcinoma 1.700 0.000
Pick disease -1.300 0.000
invasive ductal carcinoma 1.200 0.003

Synonym

Accession Q9BU19 B4DXZ0 Q5SRA5 Q5SRA6 Q9HBC9 Q9NW93 Q9NWY6 Q9UF97
Symbols AREBP
Zfp692

Gene

PDB

2D9H   2DLK  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
17097062 cloning and characterization of a novel zinc finger transcription factor referred to as AREBP. AREBP is phosphorylated at Ser(470) by AMPK.

AA Sequence

MASSPAVDVSCRRREKRRQLDARRSKCRIRLGGHMEQWCLLKERLGFSLHSQLAKFLLDRYTSSGCVLCA      1 - 70
GPEPLPPKGLQYLVLLSHAHSRECSLVPGLRGPGGQDGGLVWECSAGHTFSWGPSLSPTPSEAPKPASLP     71 - 140
HTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFPPPGEEEGEEEEDNDEDEEEMLSDAS    141 - 210
LWTYSSSPDDSEPDAPRLLPSPVTCTPKEGETPPAPAALSSPLAVPALSASSLSSRAPPPAEVRVQPQLS    211 - 280
RTPQAAQQTEALASTGSQAQSAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKK    281 - 350
YQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFCARSFRTSSNLVIHRRIHTGEKPLQCE    351 - 420
ICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESPSGPLEPCP    421 - 490
SISAPGPLGSSEGSRPSASPQAPTLLPQQ                                             491 - 519
//

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17097062 2006 AMP-activated protein kinase regulates PEPCK gene expression by direct phosphorylation of a novel zinc finger transcription factor.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.