Property Summary

NCBI Gene PubMed Count 14
PubMed Score 35.23
PubTator Score 25.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
15109578 The untagged recombinant human ThTPase (hThTPase) was expressed in E. coli and purified to homogeneity.

AA Sequence

MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAA      1 - 70
GVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKLVLLGADEEEP     71 - 140
QLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSSMLGVPAQETAPAKLIVYLQRFRPQDYQRLL    141 - 210
EVNSSRERPQETEDPDHCLG                                                      211 - 230
//

Text Mined References (18)

PMID Year Title
23707715 2013 Structural determinants of specificity and catalytic mechanism in mammalian 25-kDa thiamine triphosphatase.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20387656 [The rate of molecular evolution of mammalian soluble thiamine triphosphatase].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...