Property Summary

NCBI Gene PubMed Count 14
PubMed Score 36.67
PubTator Score 25.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (1)

AA Sequence

MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAA      1 - 70
GVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKLVLLGADEEEP     71 - 140
QLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSSMLGVPAQETAPAKLIVYLQRFRPQDYQRLL    141 - 210
EVNSSRERPQETEDPDHCLG                                                      211 - 230
//

Text Mined References (18)

PMID Year Title