Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis 2.100 0.000
osteosarcoma 1.390 0.000
lung cancer 1.100 0.000
Breast cancer 1.200 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q9BTY7 P0CB43
Symbols BRP16
BRP16L
FAM203A
FAM203B
C8orf30A
C8orf30B

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with family with sequence similarity 203, member A (FAM203A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MGEAGAGAGASGGPEASPEAEVVKLLPFLAPGARADLQAAAVRHVLALTGCGPGRALLAGQAALLQALME      1 - 70
LAPASAPARDAARALVNLAADPGLHETLLAADPGLPARLMGRALDPQWPWAEEAAAALANLSREPAPCAA     71 - 140
LMAALAAAEPADSGLERLVRALCTPGYNARAPLHYLAPLLSNLSQRPAARAFLLDPDRCVVQRLLPLTQY    141 - 210
PDSSVRRGGVVGTLRNCCFEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYLPPDKQRE    211 - 280
PDADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENL    281 - 350
LEVQVPEDVEQQLQQLDCREQEQLERELAPEPWVERATPT                                  351 - 390
//

Publication (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...