Property Summary

NCBI Gene PubMed Count 18
PubMed Score 31.32
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 0.002
medulloblastoma, large-cell -1.100 0.005
tuberculosis 1.900 0.000
posterior fossa group B ependymoma 1.100 0.000
lung carcinoma -1.500 0.000
Breast cancer 1.200 0.000
ovarian cancer 1.500 0.000

Gene RIF (5)

PMID Text
24469468 IL-13, IL-4 and IL-5 have no effect on the expression of FUCA1 and FUCA2, but its expression is upregulated by IFN-gamma, a Th1 cytokine.
22082156 Knockdown of fucosidase, alpha-L- 2, plasma (FUCA2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20800603 Observational study of gene-disease association. (HuGE Navigator)
19666478 Findings not only demonstrate an important connection between FUCA2 and the adhesion, growth, and pathogenicity of H. pylori, but also support the idea that FUCA2 is a potential target for diagnosis and therapy of H. pylori-related diseases.
18521898 serum alpha-L-fucosidase was identified as a useful marker for close monitoring of patients during post-treatment follow-up

AA Sequence

MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWFDQAKFGIFIHWGVFSVPSFG      1 - 70
SEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFT     71 - 140
LWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTL    141 - 210
PELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDR    211 - 280
YNPGHLLPHKWENCMTIDKLSWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFE    281 - 350
ERLRQMGSWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGAT    351 - 420
EVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNVI                           421 - 467
//

Text Mined References (21)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25416956 2014 A proteome-scale map of the human interactome network.
24469468 2014 Modulation of expression in BEAS-2B airway epithelial cells of ?-L-fucosidase A1 and A2 by Th1 and Th2 cytokines, and overexpression of ?-L-fucosidase 2.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19666478 2009 Role for alpha-L-fucosidase in the control of Helicobacter pylori-infected gastric cancer cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18521898 2008 Serum fucosylation changes in oral cancer and oral precancerous conditions: alpha-L-fucosidase as a marker.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...