Property Summary

Ligand Count 2
NCBI Gene PubMed Count 19
PubMed Score 32.57
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.7e-03
Breast cancer 1.200 2.0e-08
lung carcinoma -1.500 5.2e-21
medulloblastoma, large-cell -1.100 5.2e-03
ovarian cancer 1.500 4.2e-05
posterior fossa group B ependymoma 1.100 3.3e-09
tuberculosis 1.900 8.3e-09

 GO Function (1)

 MGI Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (6)

AA Sequence

MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWFDQAKFGIFIHWGVFSVPSFG      1 - 70
SEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFT     71 - 140
LWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTL    141 - 210
PELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDR    211 - 280
YNPGHLLPHKWENCMTIDKLSWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFE    281 - 350
ERLRQMGSWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGAT    351 - 420
EVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNVI                           421 - 467
//

Text Mined References (22)

PMID Year Title