Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.33
PubTator Score 2.00

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.334 0.001
pancreatic ductal adenocarcinoma liver m... -1.371 0.018
lung cancer 1.400 0.001
ovarian cancer 2.100 0.000


Accession Q9BTX3 Q05CT0 Q96D25 Q9NZZ7
Symbols HSPC171


Gene RIF (1)

23691174 novel ER-located protein regulates both ER stress and autophagy

AA Sequence

VLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL                                         141 - 173

Publication (5)

PMID Year Title
23691174 2013 Transmembrane protein 208: a novel ER-localized protein that regulates autophagy and ER stress.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.