Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.33
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.400 7.0e-04
Multiple myeloma 1.334 6.1e-04
ovarian cancer 2.100 4.3e-06
pancreatic ductal adenocarcinoma liver m... -1.371 1.8e-02

Gene RIF (1)

AA Sequence

MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHS      1 - 70
MSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVN     71 - 140
VLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL                                         141 - 173
//

Text Mined References (6)

PMID Year Title