Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.29
PubTator Score 1.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma 1.100 6.0e-04
osteosarcoma -1.427 4.3e-04
subependymal giant cell astrocytoma -1.475 1.2e-02

Synonym

Accession Q9BTV7 Q5JWL0 Q9BYK0
Symbols ik3-2
C20orf150
dJ908M14.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAAAAAGGAPGPAPGPAGPPPPAAPTSAARAPPQALRRRGDSRRRQAALFFLNNISLDGRPPSLGPGGEK      1 - 70
PPPPPAEAREPPAPPPPEPPTGLPARTPAPQGLLSPTQVPTGLGLDGQRQRKRVTSQRCSLEFLEDAVGC     71 - 140
APAQRTKHTSGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQK    141 - 210
QRHPSGGVSVSSEMVFELEGVELGADGKVVSYAKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHK    211 - 280
PAPTKSAPASTELGSDVGDTLEYNPNLLDDPQWPCGKHKRVLIFASYMTTVIEYVKPSDLKKDMNETFRE    281 - 350
KFPHVKLTLSKIRSLKREMRSLSEECSLEPVTVAMAYVYFEKLVLQGKLSKQNRKLCAGACVLLAAKISS    351 - 420
DLRKSGVTQLIDKLEERFRFNRRDLIGFEFTVLVALELALYLPENQVLPHYRRLTQQF                421 - 478
//

Text Mined References (11)

PMID Year Title