Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.39
PubTator Score 2.64

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 1.23897173653646E-6


  Differential Expression (1)

Disease log2 FC p
Pick disease -1.200 0.000


Accession Q9BTV6 Q96AB7
Symbols RRT2


PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid

 Compartment GO Term (1)

Gene RIF (1)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

GVNPEEADSAFSLLATCSFYDHALHLWEWEGN                                          421 - 452

Text Mined References (9)

PMID Year Title
23486472 2013 A modified form of diphthamide causes immunotoxin resistance in a lymphoma cell line with a deletion of the WDR85 gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19965467 2009 Haploid genetic screens in human cells identify host factors used by pathogens.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.