Property Summary

NCBI Gene PubMed Count 36
Grant Count 201
R01 Count 124
Funding $24,891,607.91
PubMed Score 688.49
PubTator Score 15.72

Knowledge Summary

Patent (448)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.252 0.001
colon cancer -1.700 0.001
lung cancer -1.100 0.020
ovarian cancer 1.100 0.000

Synonym

Accession Q9BTU6 D3DR59 Q9NSG8
Symbols PI4KII
PIK42A

Gene

PANTHER Protein Class (2)

PDB

4HND   4HNE   4PLA   4YC4   5EUT   5I0N  

Gene RIF (21)

PMID Text
26143926 Here two crystal structures are presented: the structure of human PIK42A and the structure of PIK42B containing a nucleoside analogue.
26038556 PI4KIIalpha is a specific downstream effector of GABARAP and it generates PI4P, which has a key role in the final stage of autophagy.
25940347 Rab27a is required for plasma membrane delivery of PI4K2A and HIV-1 Gag assembly in Jurkat cells
25083612 PI4K2A is a novel regulator of vesicular trafficking and neurotransmission in the brain.
25002402 phosphatidylinositol 4-kinase IIalpha knockdown inhibited vesicle-associated membrane protein 3 trafficking to perinuclear membranes and impaired the rate of VAMP3-mediated recycling of the transferrin receptor
24752359 structure and phylogenetic analysis
24675427 The palmitoylation insertion contributes to the phosphatidylinositol-binding pocket and anchors PI4KIIalpha to the membrane.
23676666 The Hermansky-Pudlak syndrome complex BLOC-1 and its cargo PI4KIIalpha interact with regulators of the actin cytoskeleton.
21218173 Knockdown of PI4KIIalpha inhibits EGF-stimulated Akt phosphorylation.
21190509 Results suggest that the phosphatidylinositol 4-kinase 2-alpha gene may not be a cause of autosomal recessive hereditary spastic paraplegia in humans.
More...

AA Sequence

MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAA      1 - 70
QGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFV     71 - 140
KDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPR    141 - 210
TKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAE    211 - 280
PLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLA    281 - 350
FPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQI    351 - 420
AVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW               421 - 479
//

Text Mined References (51)

PMID Year Title
26143926 2015 The high-resolution crystal structure of phosphatidylinositol 4-kinase II? and the crystal structure of phosphatidylinositol 4-kinase II? containing a nucleoside analogue provide a structural basis for isoform-specific inhibitor design.
26038556 2015 GABARAPs regulate PI4P-dependent autophagosome:lysosome fusion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25168678 2014 The crystal structure of the phosphatidylinositol 4-kinase II?.
25083612 2014 PI4KII? phosphorylation by GSK3 directs vesicular trafficking to lysosomes.
25002402 2014 Endosomal sorting of VAMP3 is regulated by PI4K2A.
24752359 2014 Puzzle out the regulation mechanism of PI4KII? activity.
24675427 2014 Molecular insights into the membrane-associated phosphatidylinositol 4-kinase II?.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23676666 2013 The WASH complex, an endosomal Arp2/3 activator, interacts with the Hermansky-Pudlak syndrome complex BLOC-1 and its cargo phosphatidylinositol-4-kinase type II?.
More...