Property Summary

NCBI Gene PubMed Count 40
PubMed Score 745.14
PubTator Score 15.72

Knowledge Summary

Patent (448)

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer -1.700 5.5e-04
lung cancer -1.100 2.0e-02
osteosarcoma -1.252 8.4e-04
ovarian cancer 1.100 1.0e-04

Gene RIF (25)

AA Sequence

MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAA      1 - 70
QGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFV     71 - 140
KDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPR    141 - 210
TKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAE    211 - 280
PLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLA    281 - 350
FPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQI    351 - 420
AVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW               421 - 479
//

Text Mined References (55)

PMID Year Title