Property Summary

NCBI Gene PubMed Count 8
PubMed Score 24.04
PubTator Score 17.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.300 3.0e-02
ovarian cancer 1.200 6.2e-05

Synonym

Accession Q9BTT4 C6G491
Symbols L6
NUT2
TRG20

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEY      1 - 70
IDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS          71 - 135
//

Text Mined References (13)

PMID Year Title