Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.01
PubTator Score 5.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Synonym

Accession Q9BTT0 B4E0I6 E9PEA6 Q5TB18 Q5TB20 Q8N1S4 Q8WWW9
Symbols LANPL
LANP-L

Gene

PDB

4CAY   4NFT  

Gene RIF (6)

PMID Text
26034280 Dynamic modulation of H2A.Z exchange and removal by Anp32e reveals the importance of the nucleosome surface and nucleosome dynamics in processing the damaged chromatin template during DSB repair.
24613878 Anp32e may help to resolve the non-nucleosomal H2A.Z aggregates and also facilitate the removal of H2A.Z at the +1 nucleosomes, and the latter may help RNA polymerase II to pass the first nucleosomal barrier.
24463511 1.48 A resolution crystal structure of the complex formed between the ANP32E-ZID and the H2A.Z/H2B dimer and biochemical data support an underlying molecular mechanism for H2A.Z/H2B eviction from the nucleosome and its stabilization by ANP32E
22944692 HIV-1 Rev interacting protein, acidic leucine-rich nuclear phosphoprotein 32 E (ANP32E), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with ANP32E is decreased by RRE
22174317 HIV-1 Rev interacting protein, acidic leucine-rich nuclear phosphoprotein 32 E (ANP32E), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with ANP32E is decreased by RRE
12438741 The gene was cloned and identified during large-scale sequencing analysis of a human fetal brain cDNA library.

AA Sequence

MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLE      1 - 70
LSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQ     71 - 140
QITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELG    141 - 210
EGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD                211 - 268
//

Text Mined References (25)

PMID Year Title
26034280 2015 Histone chaperone Anp32e removes H2A.Z from DNA double-strand breaks and promotes nucleosome reorganization and DNA repair.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24613878 2014 Anp32e, a higher eukaryotic histone chaperone directs preferential recognition for H2A.Z.
24463511 2014 ANP32E is a histone chaperone that removes H2A.Z from chromatin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...