Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.60
PubTator Score 5.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.029 1.6e-02
Amyotrophic lateral sclerosis 1.000 6.8e-06
Atopic dermatitis 1.100 1.4e-03
atypical teratoid / rhabdoid tumor 1.200 3.0e-04
Breast cancer 1.300 8.6e-04
colon cancer 1.100 3.5e-02
cutaneous lupus erythematosus 1.100 4.9e-03
dermatomyositis 1.200 2.0e-04
ductal carcinoma in situ 1.300 1.4e-03
gastric carcinoma 1.200 2.0e-02
glioblastoma 1.100 1.6e-04
intraductal papillary-mucinous neoplasm ... 1.500 5.4e-03
invasive ductal carcinoma 2.000 4.7e-03
lung adenocarcinoma 1.346 4.9e-04
lung cancer 1.800 1.7e-04
malignant mesothelioma 1.700 1.2e-06
medulloblastoma, large-cell 1.100 3.5e-04
Multiple myeloma 1.283 1.9e-02
non-small cell lung cancer 1.996 1.7e-29
ovarian cancer 1.900 1.6e-04
pancreatic cancer 1.300 8.5e-05
psoriasis 2.300 2.1e-05
ulcerative colitis 1.900 1.1e-06
Waldenstrons macroglobulinemia 1.667 5.1e-03

Gene RIF (7)

AA Sequence

MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLE      1 - 70
LSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQ     71 - 140
QITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELG    141 - 210
EGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD                211 - 268
//

Text Mined References (27)

PMID Year Title