Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.64
PubTator Score 8.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.3e-05
Disease Target Count Z-score Confidence
Xeroderma pigmentosum group F 22 4.117 2.1
Anemia 365 4.063 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 4.3e-05

Synonym

Accession Q9BTP7 B3KY46 Q8WUJ7 Q96FX6
Symbols C19orf40

Gene

PDB

2LYH   2M9M   2M9N   4BXO   4M6W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGN      1 - 70
GYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEP     71 - 140
SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAF    141 - 210
FTQPR                                                                     211 - 215
//

Text Mined References (19)

PMID Year Title