Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.24
PubTator Score 0.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Atopic dermatitis 1.200 1.0e-03
cutaneous lupus erythematosus 2.300 1.1e-03
cystic fibrosis 1.500 4.2e-03
esophageal adenocarcinoma -2.400 2.1e-02
interstitial cystitis 1.500 1.3e-02
lung adenocarcinoma -1.100 1.0e-11
lung cancer -3.000 2.6e-05
malignant mesothelioma -1.400 8.8e-07
non-small cell lung cancer -2.322 1.2e-13
ovarian cancer 1.800 8.7e-03
pancreatic cancer 1.200 8.1e-04
psoriasis 2.600 7.6e-04
spina bifida -2.665 2.2e-02

AA Sequence

MMRREDEEEEGTMMKAKGDLEMKEEEEISETGELVGPFVSAMPTPMPHNKGTRFSEAWEYFHLAPARAGH      1 - 70
HPNQYATCRLCGRQVSRGPGVNVGTTALWKHLKSMHREELEKSGHGQAGQRQDPRPHGPQLPTGIEGNWG     71 - 140
RLLEQVGTMALWASQREKEVLRRERAVEWRERAVEKRERALEEVERAILEMKWKVRAEKEACQREKELPA    141 - 210
AVHPFHFV                                                                  211 - 218
//

Text Mined References (5)

PMID Year Title