Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.24
PubTator Score 0.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.16255561408283E-13
lung adenocarcinoma 2714 1.92034291533106E-7
malignant mesothelioma 3163 8.77680501951556E-7
lung cancer 4473 2.55631045770933E-5
psoriasis 6685 7.6153848883964E-4
pancreatic cancer 2300 8.06499438740718E-4
Atopic dermatitis 944 9.96600234623032E-4
cutaneous lupus erythematosus 1056 0.00112139853368847
cystic fibrosis 1670 0.00416841531398929
ovarian cancer 8492 0.00873661982932556
interstitial cystitis 2299 0.0130837652838329
esophageal adenocarcinoma 737 0.0207076601830352
spina bifida 1064 0.0218452876494595

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
esophageal adenocarcinoma -2.400 0.021
cutaneous lupus erythematosus 2.300 0.001
psoriasis 2.600 0.001
Atopic dermatitis 1.200 0.001
non-small cell lung cancer -2.322 0.000
lung cancer -3.000 0.000
pancreatic cancer 1.200 0.001
interstitial cystitis 1.500 0.013
cystic fibrosis 1.500 0.004
lung adenocarcinoma -1.800 0.000
spina bifida -2.665 0.022
ovarian cancer 1.800 0.009

AA Sequence

MMRREDEEEEGTMMKAKGDLEMKEEEEISETGELVGPFVSAMPTPMPHNKGTRFSEAWEYFHLAPARAGH      1 - 70
HPNQYATCRLCGRQVSRGPGVNVGTTALWKHLKSMHREELEKSGHGQAGQRQDPRPHGPQLPTGIEGNWG     71 - 140
RLLEQVGTMALWASQREKEVLRRERAVEWRERAVEKRERALEEVERAILEMKWKVRAEKEACQREKELPA    141 - 210
AVHPFHFV                                                                  211 - 218
//

Text Mined References (5)

PMID Year Title
23533661 2013 ZBED evolution: repeated utilization of DNA transposons as regulators of diverse host functions.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.