Property Summary

NCBI Gene PubMed Count 13
PubMed Score 29.62
PubTator Score 7.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
acute myeloid leukemia 783 1.4e-02

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.400 1.4e-02

Gene RIF (5)

AA Sequence

MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVL      1 - 70
INDADWELLGELDYQLQDQDSVLFISTLHGG                                            71 - 101
//

Text Mined References (13)

PMID Year Title