Property Summary

NCBI Gene PubMed Count 13
PubMed Score 28.84
PubTator Score 7.56

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.400 0.014

Synonym

Accession Q9BTM9 B3KMH3 B4DV08 Q5T4B4
Symbols C9orf74

Gene

Gene RIF (5)

PMID Text
25747390 ubiquitin-like Urm1.Uba4 systems are conserved and exchangeable between human and yeast cells
21245332 observations suggest that Urm1 activation is more similar to that of a prokaryotic sulfur carrier protein than that of a ubiquitin-like protein
21209336 Urm1 has a conserved dual role by integrating the functions of prokaryotic sulfur carriers with those of eukaryotic protein modifiers of the Ub family
19017811 Urm1 is activated by an unusual mechanism to yield a thiocarboxylate intermediate that serves as sulfur donor in tRNA thiolation reactions
18491921 The UBA4-URM1 system represents the evolutionary link between protein conjugation and protein modification by sulfur carrier proteins.

AA Sequence

MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVL      1 - 70
INDADWELLGELDYQLQDQDSVLFISTLHGG                                            71 - 101
//

Text Mined References (13)

PMID Year Title
25747390 2015 Urmylation and tRNA thiolation functions of ubiquitin-like Uba4·Urm1 systems are conserved from yeast to man.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21245332 2011 Urm1 couples sulfur transfer to ubiquitin-like protein function in oxidative stress.
21209336 2011 Role of the ubiquitin-like protein Urm1 as a noncanonical lysine-directed protein modifier.
19017811 2008 A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway.
18491921 2008 The sulfurtransferase activity of Uba4 presents a link between ubiquitin-like protein conjugation and activation of sulfur carrier proteins.
16864801 2006 Solution structure of Urm1 and its implications for the origin of protein modifiers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16046629 2005 Three-dimensional structure of the AAH26994.1 protein from Mus musculus, a putative eukaryotic Urm1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...