Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.61
PubTator Score 6.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.500 0.000
psoriasis -1.300 0.000
cutaneous lupus erythematosus -1.200 0.005
osteosarcoma -2.159 0.000
non-small cell lung cancer -1.040 0.000
group 4 medulloblastoma 3.100 0.000
posterior fossa group A ependymoma 1.100 0.000
nasopharyngeal carcinoma -1.500 0.000
ovarian cancer 1.800 0.000
Breast cancer 1.200 0.000

Synonym

Accession Q9BTM1 Q9NV63 H2a/j
Symbols H2AJ

Gene

PDB

4EDU  

 GO Function (1)

 GO Process (1)

Gene RIF (7)

PMID Text
22174317 HIV-1 Rev interacting protein, histone H2A.J, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21178486 The antimicrobial protein buforin I results from proteolytic cleavage of the histone protein H2A in the stomach.
14657027 HIV-1 Rev interacting protein, histone H2A.J, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11689053 HIV-1 Rev interacting protein, histone H2A.J, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11331621 In this paper, the authors identified and cloned the H2AFJ gene on chr 12 and used it as a control for studying two macroH2A genes.
11080476 HIV-1 Rev interacting protein, histone H2A.J, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9566873 HIV-1 Rev interacting protein, histone H2A.J, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK                71 - 129
//

Publication (17)

PMID Year Title
25731851 2015 Nucleosome adaptability conferred by sequence and structural variations in histone H2A-H2B dimers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21178486 Antimicrobial peptides: the ancient arm of the human immune system.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16618726 2006 Combined cDNA array comparative genomic hybridization and serial analysis of gene expression analysis of breast tumor progression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15900300 2005 Analysis of differential gene expression in human melanocytic tumour lesions by custom made oligonucleotide arrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...