Property Summary

NCBI Gene PubMed Count 7
PubMed Score 13.84
PubTator Score 10.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -1.163 0.036
astrocytoma 3.000 0.001
glioblastoma 2.700 0.000
autosomal dominant Emery-Dreifuss muscul... 1.239 0.046
adrenocortical carcinoma -1.127 0.001
non-small cell lung cancer -1.173 0.000
lung cancer -2.100 0.000
colon cancer -1.400 0.000
psoriasis -1.100 0.000
inflammatory breast cancer -2.000 0.000
pterygium -1.100 0.031
acute myeloid leukemia 1.300 0.027
ovarian cancer 1.200 0.015
pituitary cancer -1.500 0.000

Gene RIF (3)

PMID Text
26260137 results from western blot analysis showed that the activity of the focal adhesion kinase (FAK) can be regulated by IER2.
22120713 ectopic Ier2 expression promoted the motility and invasiveness of poorly metastatic 1AS pancreatic tumor cells in vitro
19584537 the functioning of ETR101 as a transcriptional activator for the gene ISYNA1

AA Sequence

MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQLSLVMRSARELYLSAKVEALEPEVSLPAALPSDPR      1 - 70
LHPPREAESTAETATPDGEHPFPEPMDTQEAPTAEETSACCAPRPAKVSRKRRSSSLSDGGDAGLVPSKK     71 - 140
ARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCSPAAPPTAPPACEAKPACRPAD    141 - 210
SMLNVLVRAVVAF                                                             211 - 223
//

Text Mined References (8)

PMID Year Title
26260137 2015 Identification of immediate early response protein 2 as a regulator of angiogenesis through the modulation of endothelial cell motility and adhesion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22120713 2012 The immediate early gene Ier2 promotes tumor cell motility and metastasis, and predicts poor survival of colorectal cancer patients.
19584537 2009 Functional analyses of immediate early gene ETR101 expressed in yeast.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8175888 1994 Phorbol ester-induced transcription of an immediate-early response gene by human T cells is inhibited by co-treatment with calcium ionophore.
2061303 1991 Expression of a novel immediate early gene during 12-O-tetradecanoylphorbol-13-acetate-induced macrophagic differentiation of HL-60 cells.