Property Summary

NCBI Gene PubMed Count 8
PubMed Score 20.84
PubTator Score 10.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.300 2.7e-02
adrenocortical carcinoma -1.127 8.8e-04
astrocytoma 3.000 1.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.239 4.6e-02
colon cancer -1.400 1.0e-04
glioblastoma 2.700 3.8e-04
inflammatory breast cancer -1.900 9.7e-06
lung cancer -1.500 4.3e-04
non-small cell lung cancer -1.173 3.1e-14
osteosarcoma -1.163 3.6e-02
ovarian cancer 1.200 1.5e-02
pituitary cancer -1.500 9.4e-06
psoriasis -1.100 2.1e-06
pterygium -1.100 3.1e-02

Gene RIF (4)

AA Sequence

MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQLSLVMRSARELYLSAKVEALEPEVSLPAALPSDPR      1 - 70
LHPPREAESTAETATPDGEHPFPEPMDTQEAPTAEETSACCAPRPAKVSRKRRSSSLSDGGDAGLVPSKK     71 - 140
ARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCSPAAPPTAPPACEAKPACRPAD    141 - 210
SMLNVLVRAVVAF                                                             211 - 223
//

Text Mined References (9)

PMID Year Title