Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.91
PubTator Score 1.46

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNR      1 - 70
WGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY                           71 - 118
//

Text Mined References (17)

PMID Year Title