Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.91
PubTator Score 1.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BTL3 Q2M1J8 RAM
Symbols RAM
C15orf18
HsT19360

Gene

PDB

5E8J  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
24200467 Data suggest that RAM/FAM103A1 has three domains: N-terminal activation domain (RAD); central RNA-binding domain (NR domain); and C-terminal nuclear localization domain (QYP) which contains two nuclear localization signal sequences.
22099306 RAM is an essential component of the core gene expression machinery

AA Sequence

MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNR      1 - 70
WGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY                           71 - 118
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24200467 2014 RAM function is dependent on Kap?2-mediated nuclear entry.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22099306 2011 RAM/Fam103a1 is required for mRNA cap methylation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...