Property Summary

NCBI Gene PubMed Count 7
Grant Count 9
R01 Count 8
Funding $720,173.6
PubMed Score 0.91
PubTator Score 1.46

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24200467 Data suggest that RAM/FAM103A1 has three domains: N-terminal activation domain (RAD); central RNA-binding domain (NR domain); and C-terminal nuclear localization domain (QYP) which contains two nuclear localization signal sequences.
22099306 RAM is an essential component of the core gene expression machinery

AA Sequence

MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNR      1 - 70
WGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY                           71 - 118
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24200467 2014 RAM function is dependent on Kap?2-mediated nuclear entry.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22099306 2011 RAM/Fam103a1 is required for mRNA cap methylation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...