Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.61
PubTator Score 207.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

 GO Function (1)

Gene RIF (6)

AA Sequence

MSLARGHGDTAASTAAPLSEEGEVTSGLQALAVEDTGGPSASAGKAEDEGEGGREETEREGSGGEEAQGE      1 - 70
VPSAGGEEPAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPE     71 - 140
AQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKR    141 - 210
HKKLEEQILRTGRDLFSLDSEDPSPASPPLRSSGSSLFPRQRKY                              211 - 254
//

Text Mined References (12)

PMID Year Title