Property Summary

NCBI Gene PubMed Count 11
Grant Count 362
R01 Count 184
Funding $44,525,130.23
PubMed Score 8.19
PubTator Score 207.08

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BTK6 A2ICR6
Symbols GAS
PA1
C16orf53

Gene

 GO Function (1)

Gene RIF (6)

PMID Text
24260416 PTIP associated protein 1, PA1, is an independent prognostic factor for lymphnode negative breast cancer.
24260416 PA1 expression was observed in both nucleus (mainly)and cytoplasm from breast cancer tissue samples. PA1 nuclear expression was correlated with postmenopausal, smaller tumor size, negative Ki67, positive AR and positive ERbeta. PA1 nuclear positive cases seemed to have a longer survival than negative ones for RFS. For those patients without lymphnode metastasis PA1 was found to be an independent prognostic factor for RFS.
23161582 PA1 is a new competitive decelerator of GR transactivation and can act at more than one molecularly defined step in a manner that depends upon the specific gene
19124460 subset of PTIP.PA1 complex is recruited to DNA damage sites via the RNF8-dependent pathway and is required for cell survival in response to DNA damage.
19039327 GAS is a new transcription cofactor
17500065 PA1 (C16orf53) binds PTIP directly and requires PTIP for interaction with the MLL3- and MLL4-containing histone H3 K4 methyltransferase complex.

AA Sequence

MSLARGHGDTAASTAAPLSEEGEVTSGLQALAVEDTGGPSASAGKAEDEGEGGREETEREGSGGEEAQGE      1 - 70
VPSAGGEEPAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPE     71 - 140
AQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKR    141 - 210
HKKLEEQILRTGRDLFSLDSEDPSPASPPLRSSGSSLFPRQRKY                              211 - 254
//

Text Mined References (12)

PMID Year Title
24260416 2013 PTIP associated protein 1, PA1, is an independent prognostic factor for lymphnode negative breast cancer.
23161582 2013 PA1 protein, a new competitive decelerator acting at more than one step to impede glucocorticoid receptor-mediated transactivation.
19124460 2009 Accumulation of Pax2 transactivation domain interaction protein (PTIP) at sites of DNA breaks via RNF8-dependent pathway is required for cell survival after DNA damage.
19039327 2009 GAS, a new glutamate-rich protein, interacts differentially with SRCs and is involved in oestrogen receptor function.
17500065 2007 PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17178841 2007 Knockdown of ALR (MLL2) reveals ALR target genes and leads to alterations in cell adhesion and growth.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...