Knowledge Summary

Patent

No data available

Synonym

Accession Q9BTK2
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MEGGMAAYPVATRESRCRRGRIGVQPSPERRSEVVGPFPLARSLS                               1 - 45
//

Publication (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).