Knowledge Summary

Patent

No data available

Synonym

Accession Q9BTK2
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MEGGMAAYPVATRESRCRRGRIGVQPSPERRSEVVGPFPLARSLS                               1 - 45
//

Text Mined References (2)

PMID Year Title