Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.75
PubTator Score 8.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.8e-03
lung cancer 1.400 2.7e-03
malignant mesothelioma -2.600 2.5e-08
osteosarcoma -1.014 1.1e-02
tuberculosis and treatment for 6 months 1.500 6.3e-05

Synonym

Accession Q9BTF0 A8K7I7 Q53TT8 Q53TV0
Symbols C2orf8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MSEARGEPGSGPEAGARFFCTAGRGLEPFVMREVRARLAATQVEYISGKVFFTTCSDLNMLKKLKSAERL      1 - 70
FLLIKKQFPLIISSVSKGKIFNEMQRLINEDPGSWLNAISIWKNLLELDAKKEKLSQRDDNQLKRKVGEN     71 - 140
EIIAKKLKIEQMQKIEENRDCQLEKQIKEETLEQRDFTTKSEKFQEEEFQNDIEKAIDTHNQNDLTFRVS    141 - 210
CRCSGTIGKAFTAQEVGKVIGIAIMKHFGWKADLRNPQLEIFIHLNDIYSVVGIPVFRVSLASRAYIKTA    211 - 280
GLRSTIAWAMASLADIKAGAFVLDPMCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDK    281 - 350
IELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLSEDHHRRLTDCK    351 - 420
ESNIPFNSKDSHTDEPGIKKCLNPEEKTGAFKTASTSFEASNHKFLDRMSPFGSLVPVECYKVSLGKTDA    421 - 490
FICKYKKSHSSGL                                                             491 - 503
//

Text Mined References (7)

PMID Year Title