Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.67
PubTator Score 8.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
osteosarcoma -1.014 0.011
tuberculosis and treatment for 6 months 1.500 0.000
lung cancer 1.400 0.003
group 3 medulloblastoma 1.100 0.003

Synonym

Accession Q9BTF0 A8K7I7 Q53TT8 Q53TV0
Symbols C2orf8

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MSEARGEPGSGPEAGARFFCTAGRGLEPFVMREVRARLAATQVEYISGKVFFTTCSDLNMLKKLKSAERL      1 - 70
FLLIKKQFPLIISSVSKGKIFNEMQRLINEDPGSWLNAISIWKNLLELDAKKEKLSQRDDNQLKRKVGEN     71 - 140
EIIAKKLKIEQMQKIEENRDCQLEKQIKEETLEQRDFTTKSEKFQEEEFQNDIEKAIDTHNQNDLTFRVS    141 - 210
CRCSGTIGKAFTAQEVGKVIGIAIMKHFGWKADLRNPQLEIFIHLNDIYSVVGIPVFRVSLASRAYIKTA    211 - 280
GLRSTIAWAMASLADIKAGAFVLDPMCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDK    281 - 350
IELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLSEDHHRRLTDCK    351 - 420
ESNIPFNSKDSHTDEPGIKKCLNPEEKTGAFKTASTSFEASNHKFLDRMSPFGSLVPVECYKVSLGKTDA    421 - 490
FICKYKKSHSSGL                                                             491 - 503
//

Publication (7)

PMID Year Title
18957941 2010 Genome-wide association scan for five major dimensions of personality.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12063391 2001 Localization, genomic organization, and alternative transcription of a novel human SAM-dependent methyltransferase gene on chromosome 2p22-->p21.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.