Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.67
PubTator Score 8.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.53796309169717E-8
tuberculosis and treatment for 6 months 686 6.34825627585568E-5
lung cancer 4473 0.00273949296114209
group 3 medulloblastoma 2254 0.00278868302263645
osteosarcoma 7933 0.0107266551029642
Disease Target Count Z-score Confidence
Gingival fibromatosis 13 5.047 2.5

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
osteosarcoma -1.014 0.011
tuberculosis and treatment for 6 months 1.500 0.000
lung cancer 1.400 0.003
group 3 medulloblastoma 1.100 0.003

Synonym

Accession Q9BTF0 A8K7I7 Q53TT8 Q53TV0
Symbols C2orf8

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MSEARGEPGSGPEAGARFFCTAGRGLEPFVMREVRARLAATQVEYISGKVFFTTCSDLNMLKKLKSAERL      1 - 70
FLLIKKQFPLIISSVSKGKIFNEMQRLINEDPGSWLNAISIWKNLLELDAKKEKLSQRDDNQLKRKVGEN     71 - 140
EIIAKKLKIEQMQKIEENRDCQLEKQIKEETLEQRDFTTKSEKFQEEEFQNDIEKAIDTHNQNDLTFRVS    141 - 210
CRCSGTIGKAFTAQEVGKVIGIAIMKHFGWKADLRNPQLEIFIHLNDIYSVVGIPVFRVSLASRAYIKTA    211 - 280
GLRSTIAWAMASLADIKAGAFVLDPMCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDK    281 - 350
IELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLSEDHHRRLTDCK    351 - 420
ESNIPFNSKDSHTDEPGIKKCLNPEEKTGAFKTASTSFEASNHKFLDRMSPFGSLVPVECYKVSLGKTDA    421 - 490
FICKYKKSHSSGL                                                             491 - 503
//

Text Mined References (7)

PMID Year Title
18957941 2010 Genome-wide association scan for five major dimensions of personality.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12063391 2001 Localization, genomic organization, and alternative transcription of a novel human SAM-dependent methyltransferase gene on chromosome 2p22-->p21.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.