Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 2.3e-21
ulcerative colitis 1819 3.4e-07
diabetes mellitus 1728 1.7e-03
ovarian cancer 8520 1.9e-03
osteosarcoma 7950 2.7e-02
Disease Target Count Z-score Confidence
Laryngeal squamous cell carcinoma 3 3.385 1.7
Disease Target Count
tuberculosis 2010

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.100 1.7e-03
non-small cell lung cancer 1.255 2.3e-21
osteosarcoma 1.153 2.7e-02
ovarian cancer 1.900 1.9e-03
ulcerative colitis 1.200 3.4e-07

Synonym

Accession Q9BTE7 Q3ZTT2
Symbols SCCRO5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM      1 - 70
EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN     71 - 140
IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD    141 - 210
LSNYDEDGAWPVLLDEFVEWQKVRQTS                                               211 - 237
//

Text Mined References (20)

PMID Year Title