Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.11
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.153 0.027
non-small cell lung cancer 1.255 0.000
diabetes mellitus -1.100 0.002
ulcerative colitis 1.200 0.000
ovarian cancer 1.900 0.002

Gene RIF (2)

PMID Text
24192928 SCCRO5 has oncogenic potential that requires its function as a component of the neddylation E3. Neddylation activity and nuclear localization of SCCRO5 are important for its in vivo function.
23098533 Overexpression of DCUN1D5 is associated with laryngeal squamous cell carcinoma.

AA Sequence

MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM      1 - 70
EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN     71 - 140
IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD    141 - 210
LSNYDEDGAWPVLLDEFVEWQKVRQTS                                               211 - 237
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
24192928 2014 Oncogenic function of SCCRO5/DCUN1D5 requires its Neddylation E3 activity and nuclear localization.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098533 2012 In vitro biological characterization of DCUN1D5 in DNA damage response.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...