DCN1-like protein 5

Property Summary

NCBI Gene PubMed Count	13
PubMed Score	2.00

PubTator Score	2.00

Knowledge Summary

Patent

No data available

TINX Plot

Disease (3)

Disease	Target Count	P-value
non-small cell lung cancer	2890	2.3e-21
ulcerative colitis	1819	3.4e-07
diabetes mellitus	1728	1.7e-03
ovarian cancer	8520	1.9e-03
osteosarcoma	7950	2.7e-02

Disease	Target Count	Z-score	Confidence
Laryngeal squamous cell carcinoma	3	3.385	1.7

Disease	Target Count
tuberculosis	2010

Expression

Specificity
Differential

Differential Expression (5)

Disease	log2 FC	p
diabetes mellitus	-1.100	1.7e-03
non-small cell lung cancer	1.255	2.3e-21
osteosarcoma	1.153	2.7e-02
ovarian cancer	1.900	1.9e-03
ulcerative colitis	1.200	3.4e-07

Cells - EBV-transformed lymphocytes 18,186

Cells - Transformed fibroblasts 17,577

Testis 18,518

Uterus 17,618

Adipose - Visceral (Omentum) 17,937

Skin - Not Sun Exposed (Suprapubic) 18,081

Esophagus - Mucosa 18,076

Adipose - Subcutaneous 18,110

Vagina 17,834

Breast - Mammary Tissue 18,103

Ovary 17,971

Pituitary 18,147

Nerve - Tibial 18,007

Skin - Sun Exposed (Lower leg) 17,968

Artery - Aorta 17,896

Artery - Coronary 17,949

Thyroid 18,024

Colon - Sigmoid 18,089

Spleen 17,614

Lung 18,057

Prostate 18,213

Small Intestine - Terminal Ileum 17,954

Artery - Tibial 17,631

Muscle - Skeletal 17,778

Brain - Cerebellum 17,983

Minor Salivary Gland 18,005

Brain - Cerebellar Hemisphere 18,015

Esophagus - Gastroesophageal Junction 18,000

Esophagus - Muscularis 18,017

Stomach 17,879

Heart - Atrial Appendage 17,896

Brain - Frontal Cortex (BA9) 18,069

Brain - Spinal cord (cervical c-1) 17,973

Adrenal Gland 18,071

Brain - Cortex 18,039

Brain - Hypothalamus 18,169

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Substantia nigra 17,981

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Hippocampus 18,011

Brain - Amygdala 18,006

Colon - Transverse 17,825

Brain - Caudate (basal ganglia) 18,001

Brain - Putamen (basal ganglia) 17,863

Kidney - Cortex 17,329

Liver 18,071

Heart - Left Ventricle 18,006

Pancreas 18,123

Whole Blood 17,439

B Cells 9,086

Fetal Ovary 9,118

Fetal Testis 7,955

Adult Testis 10,836

Adult Retina 10,115

Fetal Heart 9,228

CD8 Cells 9,840

Fetal Gut 8,640

Adult Ovary 10,192

Monocytes 7,422

Adult Pancreas 9,168

Adult Frontal Cortex 9,048

CD4 Cells 7,773

Adult Prostate 8,952

Adult Heart 6,506

Adult Kidney 6,723

Adult Rectum 8,022

Adult Adrenal 8,475

Adult Urinary Bladder 7,592

NK Cells 8,475

Fetal Liver 8,402

Adrenal gland

Frontal lobe

Gut

Heart

Kidney

Liver

B-lymphocyte

Monocyte

Natural killer cell

Ovary

Pancreas

Prostate gland

Rectum

Retina

Testis

Urinary bladder

BTO:0004410

BTO:0005453

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Cervical carcinoma cell 4,944

Erythroleukemia cell 4,300

Lung 2,286

Skeletal muscle 549

See source...

See source...

Synonym

Accession	Q9BTE7 Q3ZTT2
Symbols	SCCRO5

Gene

DCUN1D5

Ortholog (13)

Species	Source	Disease
Chimp 14,136	OMA EggNOG
Macaque 12,758	Inparanoid OMA EggNOG
Mouse 16,567	Inparanoid OMA EggNOG
Rat 15,112	Inparanoid OMA EggNOG
Dog 15,069	Inparanoid OMA EggNOG
Horse 14,249	Inparanoid OMA EggNOG
Cow 15,316	Inparanoid OMA EggNOG
Pig 10,164	OMA EggNOG
Opossum 12,223	Inparanoid OMA EggNOG
Platypus 5,699	OMA EggNOG
Chicken 7,823	Inparanoid OMA
Anole lizard 10,585	Inparanoid OMA
Zebrafish 9,725	Inparanoid OMA

UniProt Keyword (3)

Complete proteome 20,231

Reference proteome 20,231

Phosphoprotein 8,216

GO Function (3)

ubiquitin conjugating enzyme binding 34

cullin family protein binding 18

ubiquitin-like protein binding 5

GO Component (1)

ubiquitin ligase complex 100

GO Process (2)

positive regulation of ubiquitin-protein... 20

protein neddylation 13

Compartment GO Term (11)

Catalytic complex 1,641

Cell 16,178

Cell part 16,177

Intracellular 14,108

Intracellular part 13,972

Macromolecular complex 5,475

Nucleoli 942

Nucleus 7,562

Transferase complex 849

Ubiquitin ligase complex 333

cellular_component 18,320

GWAS Trait (1)

Tuberculosis 73

HCA RNA Cell Line (55)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Pathway (3)

Metabolism of proteins 2,091

Neddylation 234

Post-translational protein modification 1,398

Gene RIF (2)

AA Sequence

MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM      1 - 70
EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN     71 - 140
IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD    141 - 210
LSNYDEDGAWPVLLDEFVEWQKVRQTS                                               211 - 237
//

Text Mined References (20)

Summary
Details

	PMID	Year	Title