Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.49
PubTator Score 9.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BTE3 B3KSP7 Q6IA56 Q9BVT9 Q9H916 MCM-BP
Symbols MCM-BP
C10orf119

Gene

PDB

4KG9  

 GO Function (1)

Gene RIF (8)

PMID Text
25246271 the MCMBP protein accumulates to high levels in cancer cells, whereas in normal proliferating tissue its abundance is low, indicating that MCMBP could be exploited as a novel diagnostic marker for this type of carcinoma.
24190967 Data indicate that MCM-BP binds USP7 on chromatin and can mediate an interaction between the USP7 and MCM proteins.
22540012 MCM-BP can decrease phosphorylation by DDK but is not a substrate.
22250201 results suggest that MCM-BP makes multiple contributions to human cells that are not limited to unloading of the MCM complex
21196493 MCM-BP silencing in human cells also delays MCM dissociation in late S phase
20090939 Knockdown of the human ETG1 results in defective chromatid cohesion.
17296731 MCM-BP is conserved in multicellular eukaryotes and shares limited homology with MCM proteins. MCM-BP formed a complex with MCM3 to MCM7, which excluded MCM2.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPCGEDWLSHPLGIVQGFFAQNGVNPDWEKKVIEYFKEKLKENNAPKWVPSLNEVPLHYLKPNSFVKFRC      1 - 70
MIQDMFDPEFYMGVYETVNQNTKAHVLHFGKYRDVAECGPQQELDLNSPRNTTLERQTFYCVPVPGESTW     71 - 140
VKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEA    141 - 210
STGQQLNSLNLSSPFDLNFPLPGEKGPACLVKVYEDWDCFKVNDILELYGILSVDPVLSILNNDERDASA    211 - 280
LLDPMECTDTAEEQRVHSPPASLVPRIHVILAQKLQHINPLLPACLNKEESKTCKFVSSFMSELSPVRAE    281 - 350
LLGFLTHALLGDSLAAEYLILHLISTVYTRRDVLPLGKFTVNLSGCPRNSTFTEHLYRIIQHLVPASFRL    351 - 420
QMTIENMNHLKFIPHKDYTANRLVSGLLQLPSNTSLVIDETLLEQGQLDTPGVHNVTALSNLITWQKVDY    421 - 490
DFSYHQMEFPCNINVFITSEGRSLLPADCQIHLQPQLIPPNMEEYMNSLLSAVLPSVLNKFRIYLTLLRF    491 - 560
LEYSISDEITKAVEDDFVEMRKNDPQSITADDLHQLLVVARCLSLSAGQTTLSRERWLRAKQLESLRRTR    561 - 630
LQQQKCVNGNEL                                                              631 - 642
//

Publication (30)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
25246271 2014 Deregulation of the replisome factor MCMBP prompts oncogenesis in colorectal carcinomas through chromosomal instability.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24190967 2014 A role for USP7 in DNA replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
22250201 2012 The MCM-associated protein MCM-BP is important for human nuclear morphology.
More...