Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.60
PubTator Score 9.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.016 1.6e-05
group 3 medulloblastoma 1.400 1.3e-03
malignant mesothelioma 1.100 6.6e-06
medulloblastoma, large-cell 1.100 8.3e-05
non primary Sjogren syndrome sicca 1.200 2.7e-02
osteosarcoma 1.154 3.7e-04
ovarian cancer 2.200 4.9e-05
primary pancreatic ductal adenocarcinoma 1.174 2.9e-02
primitive neuroectodermal tumor 1.200 1.1e-02

 GO Function (1)

Gene RIF (8)

AA Sequence

MPCGEDWLSHPLGIVQGFFAQNGVNPDWEKKVIEYFKEKLKENNAPKWVPSLNEVPLHYLKPNSFVKFRC      1 - 70
MIQDMFDPEFYMGVYETVNQNTKAHVLHFGKYRDVAECGPQQELDLNSPRNTTLERQTFYCVPVPGESTW     71 - 140
VKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEA    141 - 210
STGQQLNSLNLSSPFDLNFPLPGEKGPACLVKVYEDWDCFKVNDILELYGILSVDPVLSILNNDERDASA    211 - 280
LLDPMECTDTAEEQRVHSPPASLVPRIHVILAQKLQHINPLLPACLNKEESKTCKFVSSFMSELSPVRAE    281 - 350
LLGFLTHALLGDSLAAEYLILHLISTVYTRRDVLPLGKFTVNLSGCPRNSTFTEHLYRIIQHLVPASFRL    351 - 420
QMTIENMNHLKFIPHKDYTANRLVSGLLQLPSNTSLVIDETLLEQGQLDTPGVHNVTALSNLITWQKVDY    421 - 490
DFSYHQMEFPCNINVFITSEGRSLLPADCQIHLQPQLIPPNMEEYMNSLLSAVLPSVLNKFRIYLTLLRF    491 - 560
LEYSISDEITKAVEDDFVEMRKNDPQSITADDLHQLLVVARCLSLSAGQTTLSRERWLRAKQLESLRRTR    561 - 630
LQQQKCVNGNEL                                                              631 - 642
//

Text Mined References (30)

PMID Year Title