Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.65
PubTator Score 1.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.100 0.027
psoriasis 1.300 0.000
cutaneous lupus erythematosus 1.100 0.002
osteosarcoma -1.454 0.000
glioblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
group 4 medulloblastoma 1.600 0.000
medulloblastoma, large-cell 1.700 0.000
non-small cell lung cancer 1.071 0.000
lung cancer 1.300 0.000
pediatric high grade glioma 1.200 0.000
Breast cancer 1.100 0.000

Gene RIF (1)

PMID Text
20508983 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIR      1 - 70
PPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVV     71 - 140
PPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV                                141 - 182
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23455152 2013 Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...