Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.71
PubTator Score 1.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 3.2e-08
Breast cancer 1.100 2.9e-09
cutaneous lupus erythematosus 1.100 2.0e-03
ependymoma -1.100 2.7e-02
glioblastoma 1.100 4.5e-05
group 4 medulloblastoma 1.600 4.9e-05
lung cancer 1.100 7.5e-03
medulloblastoma, large-cell -1.200 5.9e-03
non-small cell lung cancer 1.071 4.4e-13
osteosarcoma -1.454 8.7e-07
pediatric high grade glioma 1.200 7.4e-05
psoriasis 1.300 2.9e-07

Gene RIF (1)

AA Sequence

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIR      1 - 70
PPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVV     71 - 140
PPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV                                141 - 182
//

Text Mined References (16)

PMID Year Title