Property Summary

NCBI Gene PubMed Count 16
Grant Count 170
R01 Count 67
Funding $29,338,366.75
PubMed Score 1028.12
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BTE0 B2R7F0 Q9BTD0 Q9Y3T3
Symbols EBSP, hNATL

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
20031577 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19139211 no evidence was found for association of SNPs mapping to the NAT9, SLC9A3R1 and RAPTOR loci with susceptibility to psoriatic arthritis
16944568 Results suggest that hNATL may play an important role in the development of embryo brain and may also be important for function of adult brain and gonad

AA Sequence

MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVL      1 - 70
DAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTK     71 - 140
FEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC       141 - 207
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21688147 2012 Characterization, expression profile, polymorphism and association of porcine NAT9 gene.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
19139211 2009 Investigation of association of genes NAT9, SLC9A3R1 and RAPTOR on chromosome 17q25 with psoriatic arthritis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16944568 2006 [Cloning and expression analysis of human N-acetyltransferase doman containing gene hNATL].
16381901 2006 The LIFEdb database in 2006.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
More...