Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1070.89
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BTE0 B2R7F0 Q9BTD0 Q9Y3T3
Symbols EBSP, hNATL

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVL      1 - 70
DAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTK     71 - 140
FEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC       141 - 207
//

Text Mined References (19)

PMID Year Title