Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.39
PubTator Score 8.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q9BTD3
Symbols hole
TMEM121A

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MVLPPPDRRHVCLTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVAVWVGAEVRTA      1 - 70
KRGYAMILWFLYIFVLEIKLYFIFQNYKAARRGAADPVARKALTLLLSVCVPGLFLLLVALDRMEYVRTF     71 - 140
RKREDLRGRLFWVALDLLDLLDMQASLWEPPRSGLPLWAEGLTFFYCYMLLLVLPCVALSEVSMQGEHIA    141 - 210
PQKMMLYPVLSLATVNVVAVLARAANMALFRDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALS    211 - 280
LELQPPPPQRNSVPPPPPPLHGPPGRPHMSSPTRDPLDT                                   281 - 319
//

Text Mined References (6)

PMID Year Title